Detailed information NTG0738658

Bioinformatically predicted

Overview

• Name: comP
• Type: Machinery gene
• Locus tag: OE961_RS08300
• Genome accession: NZ_CP107223
• Coordinates: 1576941..1577390 (-)
• Length: 149 a.a.
• NCBI ID: WP_002214937.1
• Uniprot ID: A0AA44U8B7
• Organism: Neisseria gonorrhoeae strain H035
• Function: DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type	MGE coordinates	Gene coordinates	Relative position	Distance (bp)
Genomic island	1570388..1584670	1576941..1577390	within	0

Gene organization within MGE regions

Location: 1570388..1584670

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
OE961_RS08245 (OE961_08245)	-	1570388..1570666 (-)	279	WP_003691583.1	hypothetical protein	-
OE961_RS08250 (OE961_08250)	-	1570673..1570891 (-)	219	WP_003691584.1	major capsid protein	-
OE961_RS08255 (OE961_08255)	-	1570965..1571162 (-)	198	WP_003689600.1	hypothetical protein	-
OE961_RS08260 (OE961_08260)	-	1571167..1571457 (-)	291	WP_012503914.1	hypothetical protein	-
OE961_RS08265 (OE961_08265)	-	1571502..1572849 (-)	1348	Protein_1594	replication initiation factor domain-containing protein	-
OE961_RS08270 (OE961_08270)	-	1572988..1573410 (-)	423	WP_003691751.1	very short patch repair endonuclease	-
OE961_RS08275 (OE961_08275)	-	1573416..1574012 (-)	597	WP_012503916.1	TIGR02391 family protein	-
OE961_RS08280 (OE961_08280)	-	1574202..1575059 (-)	858	WP_012503917.1	ATP-binding protein	-
OE961_RS08285 (OE961_08285)	-	1575073..1575444 (-)	372	WP_012503918.1	DNA cytosine methyltransferase	-
OE961_RS08290 (OE961_08290)	-	1575441..1576049 (-)	609	WP_080229275.1	DNA cytosine methyltransferase	-
OE961_RS08295 (OE961_08295)	-	1576418..1576564 (+)	147	WP_003691757.1	hypothetical protein	-
OE961_RS08300 (OE961_08300)	comP	1576941..1577390 (-)	450	WP_002214937.1	type IV pilin protein	Machinery gene
OE961_RS08305 (OE961_08305)	comE	1577478..1577873 (-)	396	WP_003703428.1	helix-hairpin-helix domain-containing protein	Machinery gene
OE961_RS08310 (OE961_08310)	-	1577978..1578094 (-)	117	Protein_1603	competence protein ComE	-
OE961_RS08340 (OE961_08340)	-	1583719..1584372 (-)	654	Protein_1604	TIGR01621 family pseudouridine synthase	-
OE961_RS08345 (OE961_08345)	-	1584326..1584670 (-)	345	WP_003691787.1	HAD hydrolase family protein	-

Sequence

Protein

• Length: 149 a.a.
• Molecular weight: 16834.81 Da
• Isoelectric Point: 9.7951

>NTDB_id=738658 OE961_RS08300 WP_002214937.1 1576941..1577390(-) (comP) [Neisseria gonorrhoeae strain H035]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK

Nucleotide

• Length: 450 bp

>NTDB_id=738658 OE961_RS08300 WP_002214937.1 1576941..1577390(-) (comP) [Neisseria gonorrhoeae strain H035]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG

Domains

Predicted by InterproScan.

• Type IV minor pilin ComP, DNA uptake sequence receptor (ComP_DUS) (28-107)

• Prokaryotic N-terminal methylation motif (N_methyl) (1-27)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comP	Neisseria gonorrhoeae MS11	100	100	1
comP	Neisseria meningitidis 8013	99.329	100	0.993
comP	Neisseria subflava NJ9703	49.66	98.658	0.49