Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   OD347_RS14980 Genome accession   NZ_CP107079
Coordinates   2960325..2960465 (-) Length   46 a.a.
NCBI ID   WP_013353398.1    Uniprot ID   P06532
Organism   Bacillus velezensis strain LT-2     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2955325..2965465
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OD347_RS14955 - 2955665..2956048 (-) 384 WP_045509485.1 hotdog fold thioesterase -
  OD347_RS14960 comA 2956070..2956714 (-) 645 WP_014472195.1 response regulator transcription factor Regulator
  OD347_RS14965 comP 2956795..2959086 (-) 2292 WP_088613350.1 histidine kinase Regulator
  OD347_RS14970 comX 2959098..2959262 (-) 165 WP_007613432.1 competence pheromone ComX -
  OD347_RS14975 - 2959262..2960173 (-) 912 WP_088613883.1 polyprenyl synthetase family protein -
  OD347_RS14980 degQ 2960325..2960465 (-) 141 WP_013353398.1 degradation enzyme regulation protein DegQ Regulator
  OD347_RS14985 - 2960930..2961271 (+) 342 WP_045509476.1 hypothetical protein -
  OD347_RS14990 - 2961278..2962501 (-) 1224 WP_045509474.1 EAL and HDOD domain-containing protein -
  OD347_RS14995 - 2962631..2964097 (-) 1467 WP_088613351.1 nicotinate phosphoribosyltransferase -
  OD347_RS15000 - 2964115..2964666 (-) 552 WP_088613352.1 cysteine hydrolase family protein -
  OD347_RS15005 - 2964747..2965142 (-) 396 WP_013353403.1 YueI family protein -
  OD347_RS15010 - 2965208..2965456 (-) 249 WP_088613353.1 YueH family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5532.37 Da        Isoelectric Point: 6.2567

>NTDB_id=737970 OD347_RS14980 WP_013353398.1 2960325..2960465(-) (degQ) [Bacillus velezensis strain LT-2]
MEKKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=737970 OD347_RS14980 WP_013353398.1 2960325..2960465(-) (degQ) [Bacillus velezensis strain LT-2]
GTGGAAAAGAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB P06532

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

91.304

100

0.913