Detailed information    

insolico Bioinformatically predicted

Overview


Name   phrC   Type   Regulator
Locus tag   OD347_RS01975 Genome accession   NZ_CP107079
Coordinates   388116..388235 (+) Length   39 a.a.
NCBI ID   WP_013351005.1    Uniprot ID   A0AAP7N4M9
Organism   Bacillus velezensis strain LT-2     
Function   antagonize RapC (predicted from homology)   
Competence regulation

Genomic Context


Location: 383116..393235
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OD347_RS01960 - 384728..385411 (+) 684 WP_088612146.1 response regulator transcription factor -
  OD347_RS01965 - 385398..386825 (+) 1428 WP_162495005.1 HAMP domain-containing sensor histidine kinase -
  OD347_RS01970 rapC 386984..388132 (+) 1149 WP_088612148.1 tetratricopeptide repeat protein Regulator
  OD347_RS01975 phrC 388116..388235 (+) 120 WP_013351005.1 PhrC/PhrF family phosphatase-inhibitory pheromone Regulator
  OD347_RS01980 - 388383..388484 (-) 102 WP_013351006.1 YjcZ family sporulation protein -
  OD347_RS01985 - 388579..389943 (-) 1365 WP_088612149.1 aspartate kinase -
  OD347_RS01990 ceuB 390357..391310 (+) 954 WP_013351008.1 ABC transporter permease Machinery gene
  OD347_RS01995 - 391300..392247 (+) 948 WP_003156331.1 iron chelate uptake ABC transporter family permease subunit -
  OD347_RS02000 - 392241..392999 (+) 759 WP_088612150.1 ABC transporter ATP-binding protein -

Sequence


Protein


Download         Length: 39 a.a.        Molecular weight: 4228.96 Da        Isoelectric Point: 8.0285

>NTDB_id=737918 OD347_RS01975 WP_013351005.1 388116..388235(+) (phrC) [Bacillus velezensis strain LT-2]
MKLKSKWFVICLAAAAIFTAAGVSQTDQAEFHVAERGMT

Nucleotide


Download         Length: 120 bp        

>NTDB_id=737918 OD347_RS01975 WP_013351005.1 388116..388235(+) (phrC) [Bacillus velezensis strain LT-2]
ATGAAATTGAAATCTAAATGGTTTGTTATTTGTTTAGCAGCCGCCGCGATTTTTACAGCTGCAGGTGTAAGCCAGACAGA
TCAGGCTGAATTCCATGTGGCTGAAAGAGGAATGACGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  phrC Bacillus subtilis subsp. subtilis str. 168

80

100

0.821