Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   OCI51_RS13825 Genome accession   NZ_CP106862
Coordinates   2685031..2685615 (-) Length   194 a.a.
NCBI ID   WP_257522298.1    Uniprot ID   -
Organism   Lysinibacillus capsici strain FN9     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 2656544..2708120 2685031..2685615 within 0


Gene organization within MGE regions


Location: 2656544..2708120
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  OCI51_RS13620 (OCI51_13620) - 2656544..2657245 (-) 702 WP_081977510.1 peptidoglycan recognition family protein -
  OCI51_RS13625 (OCI51_13625) - 2657245..2657511 (-) 267 WP_036079338.1 holin -
  OCI51_RS13630 (OCI51_13630) - 2657513..2657836 (-) 324 WP_004227828.1 hypothetical protein -
  OCI51_RS13635 (OCI51_13635) - 2657904..2658059 (-) 156 WP_257522528.1 XkdX family protein -
  OCI51_RS13640 (OCI51_13640) - 2658059..2658274 (-) 216 WP_257522262.1 XkdW family protein -
  OCI51_RS13645 (OCI51_13645) - 2658274..2660700 (-) 2427 WP_257522263.1 Ig-like domain-containing protein -
  OCI51_RS13650 (OCI51_13650) - 2660703..2661302 (-) 600 WP_257522264.1 hypothetical protein -
  OCI51_RS13655 (OCI51_13655) - 2661295..2661603 (-) 309 WP_257522265.1 hypothetical protein -
  OCI51_RS13660 (OCI51_13660) - 2661600..2662268 (-) 669 WP_257522266.1 DUF2612 domain-containing protein -
  OCI51_RS13665 (OCI51_13665) - 2662261..2663439 (-) 1179 WP_257522267.1 baseplate J/gp47 family protein -
  OCI51_RS13670 (OCI51_13670) - 2663417..2663773 (-) 357 WP_257522268.1 hypothetical protein -
  OCI51_RS13675 (OCI51_13675) - 2663783..2664097 (-) 315 WP_257522269.1 PAAR domain-containing protein -
  OCI51_RS13680 (OCI51_13680) - 2664115..2664612 (-) 498 WP_257522270.1 Gp138 family membrane-puncturing spike protein -
  OCI51_RS13685 (OCI51_13685) - 2664609..2665445 (-) 837 WP_257522271.1 phage protein -
  OCI51_RS13690 (OCI51_13690) - 2665438..2665755 (-) 318 WP_257522272.1 phage baseplate plug protein -
  OCI51_RS13695 (OCI51_13695) - 2665752..2666276 (-) 525 WP_257522273.1 phage baseplate protein -
  OCI51_RS13700 (OCI51_13700) - 2666288..2668426 (-) 2139 WP_257522274.1 phage tail tape measure protein -
  OCI51_RS13705 (OCI51_13705) - 2668431..2668664 (-) 234 WP_257522275.1 hypothetical protein -
  OCI51_RS13710 (OCI51_13710) - 2668678..2668947 (-) 270 WP_257522276.1 hypothetical protein -
  OCI51_RS13715 (OCI51_13715) - 2668977..2669366 (-) 390 WP_257522277.1 DUF3277 family protein -
  OCI51_RS13720 (OCI51_13720) - 2669380..2670405 (-) 1026 WP_257522278.1 DUF3383 domain-containing protein -
  OCI51_RS13725 (OCI51_13725) - 2670410..2670895 (-) 486 WP_257522279.1 LIC_12616 family protein -
  OCI51_RS13730 (OCI51_13730) - 2670892..2671233 (-) 342 WP_257522280.1 hypothetical protein -
  OCI51_RS13735 (OCI51_13735) - 2671233..2671694 (-) 462 WP_257522281.1 hypothetical protein -
  OCI51_RS13740 (OCI51_13740) - 2671695..2672069 (-) 375 WP_257522282.1 DUF4054 domain-containing protein -
  OCI51_RS13745 (OCI51_13745) - 2672091..2672411 (-) 321 WP_257522283.1 hypothetical protein -
  OCI51_RS13750 (OCI51_13750) - 2672411..2673310 (-) 900 WP_257522284.1 DUF2184 domain-containing protein -
  OCI51_RS13755 (OCI51_13755) - 2673327..2673773 (-) 447 WP_257522285.1 hypothetical protein -
  OCI51_RS13760 (OCI51_13760) - 2673800..2674921 (-) 1122 WP_257522286.1 DUF2213 domain-containing protein -
  OCI51_RS13765 (OCI51_13765) - 2675215..2675985 (-) 771 WP_257522287.1 phage minor head protein -
  OCI51_RS13770 (OCI51_13770) - 2675978..2677318 (-) 1341 WP_257522288.1 DUF1073 domain-containing protein -
  OCI51_RS13775 (OCI51_13775) terL 2677325..2678785 (-) 1461 WP_257522529.1 phage terminase large subunit -
  OCI51_RS13780 (OCI51_13780) - 2678772..2679734 (-) 963 WP_257522289.1 terminase small subunit -
  OCI51_RS13785 (OCI51_13785) - 2679862..2680416 (-) 555 WP_263081756.1 hypothetical protein -
  OCI51_RS13790 (OCI51_13790) - 2680885..2681370 (-) 486 WP_257522291.1 sigma-70 family RNA polymerase sigma factor -
  OCI51_RS13795 (OCI51_13795) - 2681810..2682097 (+) 288 WP_257522292.1 hydrolase -
  OCI51_RS13800 (OCI51_13800) - 2682431..2682553 (+) 123 WP_257522293.1 hypothetical protein -
  OCI51_RS13805 (OCI51_13805) - 2682607..2683038 (-) 432 WP_257522294.1 ASCH domain-containing protein -
  OCI51_RS13810 (OCI51_13810) - 2683019..2683537 (-) 519 WP_257522295.1 hypothetical protein -
  OCI51_RS13815 (OCI51_13815) - 2683549..2684292 (-) 744 WP_257522296.1 hypothetical protein -
  OCI51_RS13820 (OCI51_13820) - 2684295..2684840 (-) 546 WP_257522297.1 Holliday junction resolvase RecU -
  OCI51_RS28005 - 2684830..2685018 (-) 189 WP_312130982.1 DUF6011 domain-containing protein -
  OCI51_RS13825 (OCI51_13825) ssbA 2685031..2685615 (-) 585 WP_257522298.1 single-stranded DNA-binding protein Machinery gene
  OCI51_RS13830 (OCI51_13830) - 2685608..2685910 (-) 303 WP_257522299.1 DUF6877 family protein -
  OCI51_RS13835 (OCI51_13835) - 2685915..2686922 (-) 1008 WP_257522300.1 DnaD domain-containing protein -
  OCI51_RS13840 (OCI51_13840) - 2687111..2687830 (-) 720 WP_237898075.1 ERF family protein -
  OCI51_RS13845 (OCI51_13845) - 2687936..2688094 (-) 159 WP_257522301.1 hypothetical protein -
  OCI51_RS13850 (OCI51_13850) - 2688288..2688422 (-) 135 WP_255409617.1 hypothetical protein -
  OCI51_RS13855 (OCI51_13855) - 2688483..2688758 (-) 276 WP_257522302.1 hypothetical protein -
  OCI51_RS13860 (OCI51_13860) - 2688746..2689024 (-) 279 WP_237898078.1 helix-turn-helix domain-containing protein -
  OCI51_RS13865 (OCI51_13865) - 2689159..2689467 (-) 309 WP_257522303.1 hypothetical protein -
  OCI51_RS13870 (OCI51_13870) - 2689464..2690186 (-) 723 WP_257522304.1 Rha family transcriptional regulator -
  OCI51_RS13875 (OCI51_13875) - 2690374..2690640 (-) 267 WP_237898081.1 helix-turn-helix transcriptional regulator -
  OCI51_RS13880 (OCI51_13880) - 2690712..2690945 (-) 234 WP_257522305.1 helix-turn-helix transcriptional regulator -
  OCI51_RS13885 (OCI51_13885) - 2691104..2691466 (+) 363 WP_263081762.1 helix-turn-helix domain-containing protein -
  OCI51_RS13890 (OCI51_13890) - 2691560..2691754 (+) 195 WP_237898084.1 hypothetical protein -
  OCI51_RS13895 (OCI51_13895) - 2692088..2693182 (+) 1095 WP_263081764.1 beta family protein -
  OCI51_RS13900 (OCI51_13900) - 2693192..2694001 (-) 810 WP_257522307.1 sce7726 family protein -
  OCI51_RS13905 (OCI51_13905) - 2694111..2694425 (+) 315 WP_257522308.1 type II toxin-antitoxin system RelE/ParE family toxin -
  OCI51_RS13910 (OCI51_13910) - 2694442..2695509 (+) 1068 WP_257522309.1 ImmA/IrrE family metallo-endopeptidase -
  OCI51_RS13915 (OCI51_13915) - 2695602..2696102 (+) 501 WP_257522310.1 ImmA/IrrE family metallo-endopeptidase -
  OCI51_RS13920 (OCI51_13920) - 2696239..2697408 (+) 1170 WP_257522311.1 site-specific integrase -
  OCI51_RS13925 (OCI51_13925) - 2697737..2698273 (-) 537 WP_257522312.1 DUF4355 domain-containing protein -
  OCI51_RS13930 (OCI51_13930) - 2698479..2698700 (-) 222 WP_066036394.1 hypothetical protein -
  OCI51_RS13935 (OCI51_13935) - 2698842..2699858 (-) 1017 WP_257522313.1 phage head morphogenesis protein -
  OCI51_RS13940 (OCI51_13940) - 2699855..2700211 (-) 357 WP_221682902.1 phage portal protein -
  OCI51_RS13945 (OCI51_13945) - 2700190..2700729 (-) 540 Protein_2732 PBSX family phage terminase large subunit -
  OCI51_RS13950 (OCI51_13950) terS 2700729..2701511 (-) 783 Protein_2733 phage terminase small subunit -
  OCI51_RS13955 (OCI51_13955) - 2701907..2702674 (+) 768 WP_257522314.1 MerR family transcriptional regulator -
  OCI51_RS13960 (OCI51_13960) - 2702711..2703124 (-) 414 WP_257522315.1 LuxR C-terminal-related transcriptional regulator -
  OCI51_RS13965 (OCI51_13965) - 2703351..2703647 (+) 297 WP_257522316.1 hypothetical protein -
  OCI51_RS13970 (OCI51_13970) - 2703704..2703940 (+) 237 WP_257522317.1 hypothetical protein -
  OCI51_RS13975 (OCI51_13975) - 2704056..2704178 (+) 123 WP_004230338.1 hypothetical protein -
  OCI51_RS13980 (OCI51_13980) - 2704333..2704521 (+) 189 WP_257522318.1 hypothetical protein -
  OCI51_RS13985 (OCI51_13985) - 2704564..2704785 (-) 222 WP_004225265.1 hypothetical protein -
  OCI51_RS13990 (OCI51_13990) - 2704884..2705705 (-) 822 WP_257522319.1 DUF2785 domain-containing protein -
  OCI51_RS13995 (OCI51_13995) - 2705963..2706148 (-) 186 WP_257522320.1 hypothetical protein -
  OCI51_RS14000 (OCI51_14000) - 2706295..2706555 (+) 261 WP_221682912.1 hypothetical protein -
  OCI51_RS14005 (OCI51_14005) - 2706727..2707257 (+) 531 WP_221682913.1 hypothetical protein -
  OCI51_RS14010 (OCI51_14010) - 2707433..2707630 (-) 198 WP_221682968.1 hypothetical protein -
  OCI51_RS14015 (OCI51_14015) - 2707602..2708120 (-) 519 Protein_2746 terminase small subunit -

Sequence

Protein


Download         Length: 194 a.a.        Molecular weight: 21591.55 Da        Isoelectric Point: 5.8977

>NTDB_id=736144 OCI51_RS13825 WP_257522298.1 2685031..2685615(-) (ssbA) [Lysinibacillus capsici strain FN9]
MINRVVLVGRLTKDPELRYTPNGIASCRFTVAINRTFANQNGERDADFINCQAWRKAAENLANYQRKGALIGLEGRIQTH
SYEDQNGQRVYTTTVVADSIQFLESRSQASGQQQPNSYSSQQQQPQYGGQAYGNKQPNYAGGQSQQQFGGPMPGQGAYQQ
NQPPMNQSSYTRVDEDPFANSRGPIEVSDDDLPF

Nucleotide


Download         Length: 585 bp        

>NTDB_id=736144 OCI51_RS13825 WP_257522298.1 2685031..2685615(-) (ssbA) [Lysinibacillus capsici strain FN9]
ATGATTAATCGTGTCGTATTAGTTGGCCGTCTTACAAAAGATCCTGAGTTACGTTACACACCGAACGGTATAGCATCATG
CCGCTTCACAGTAGCCATTAACCGTACATTTGCCAATCAAAATGGTGAGCGTGATGCAGATTTTATTAACTGCCAAGCAT
GGCGTAAAGCAGCTGAAAATCTAGCAAACTATCAGCGCAAAGGGGCACTGATTGGTTTAGAAGGTCGTATTCAAACGCAT
AGTTACGAGGATCAGAATGGACAAAGGGTGTATACCACAACGGTTGTAGCGGACAGTATCCAATTTTTAGAGTCACGTAG
TCAAGCTAGTGGTCAACAGCAGCCTAATTCATATTCATCACAACAGCAACAACCTCAATATGGCGGACAAGCTTACGGCA
ACAAACAGCCAAACTATGCCGGCGGGCAATCACAGCAACAATTCGGTGGTCCTATGCCAGGGCAAGGTGCTTATCAGCAA
AATCAGCCGCCTATGAATCAATCTAGCTATACAAGAGTAGATGAGGACCCATTTGCGAATAGTCGAGGACCGATAGAAGT
GTCTGATGATGATTTGCCATTTTAG

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

48.969

100

0.49
  ssb Latilactobacillus sakei subsp. sakei 23K

47.423

100

0.474
  ssb Neisseria meningitidis MC58

34.826

100

0.361