Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   ND010_RS02345 Genome accession   NZ_CP106826
Coordinates   453797..454405 (+) Length   202 a.a.
NCBI ID   WP_215318018.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 9464     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 444419..499901 453797..454405 within 0


Gene organization within MGE regions


Location: 444419..499901
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  ND010_RS02290 (ND010_02290) - 444419..445495 (-) 1077 WP_003701047.1 sulfate/molybdate ABC transporter ATP-binding protein -
  ND010_RS02295 (ND010_02295) - 445518..445652 (-) 135 Protein_447 IS5/IS1182 family transposase -
  ND010_RS02300 (ND010_02300) cysW 445636..446457 (-) 822 WP_260236886.1 sulfate ABC transporter permease subunit CysW -
  ND010_RS02305 (ND010_02305) cysT 446646..447482 (-) 837 WP_260236887.1 sulfate ABC transporter permease subunit CysT -
  ND010_RS02310 (ND010_02310) - 447663..447995 (+) 333 WP_003687908.1 hypothetical protein -
  ND010_RS02315 (ND010_02315) - 448354..448863 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  ND010_RS02320 (ND010_02320) - 449093..449674 (-) 582 WP_003701053.1 superoxide dismutase -
  ND010_RS02325 (ND010_02325) dnaB 449837..451243 (+) 1407 WP_241532347.1 replicative DNA helicase -
  ND010_RS02330 (ND010_02330) pilH 451551..452216 (+) 666 WP_260236888.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  ND010_RS02335 (ND010_02335) pilI 452245..452853 (+) 609 WP_033910489.1 type IV pilus modification protein PilV Machinery gene
  ND010_RS02340 (ND010_02340) pilJ 452850..453818 (+) 969 WP_260236889.1 PilW family protein Machinery gene
  ND010_RS02345 (ND010_02345) pilK 453797..454405 (+) 609 WP_215318018.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  ND010_RS02350 (ND010_02350) pilL 454407..454880 (+) 474 WP_260237126.1 PilX family type IV pilin Machinery gene
  ND010_RS02355 (ND010_02355) - 455492..455937 (-) 446 Protein_459 AzlC family ABC transporter permease -
  ND010_RS02360 (ND010_02360) dut 456103..456555 (+) 453 WP_260236890.1 dUTP diphosphatase -
  ND010_RS02365 (ND010_02365) dapC 456633..457820 (+) 1188 WP_260236891.1 succinyldiaminopimelate transaminase -
  ND010_RS02370 (ND010_02370) yaaA 458131..458910 (+) 780 WP_260236892.1 peroxide stress protein YaaA -
  ND010_RS02385 (ND010_02385) - 459441..460633 (+) 1193 Protein_463 tyrosine-type recombinase/integrase -
  ND010_RS02390 (ND010_02390) - 460988..461257 (-) 270 WP_003687928.1 hypothetical protein -
  ND010_RS02395 (ND010_02395) - 461452..462135 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  ND010_RS11850 - 462416..462682 (-) 267 Protein_466 hypothetical protein -
  ND010_RS02405 (ND010_02405) - 462793..463008 (-) 216 WP_003691538.1 hypothetical protein -
  ND010_RS02410 (ND010_02410) - 463060..463551 (-) 492 WP_260236893.1 siphovirus Gp157 family protein -
  ND010_RS02415 (ND010_02415) - 463548..463730 (-) 183 WP_260236894.1 hypothetical protein -
  ND010_RS02420 (ND010_02420) - 463870..464556 (-) 687 WP_042758540.1 phage replication initiation protein, NGO0469 family -
  ND010_RS02425 (ND010_02425) - 464625..464786 (-) 162 WP_003702497.1 hypothetical protein -
  ND010_RS02430 (ND010_02430) - 464783..465061 (-) 279 WP_003691529.1 NGO1622 family putative holin -
  ND010_RS02435 (ND010_02435) - 465214..465546 (-) 333 WP_003687946.1 hypothetical protein -
  ND010_RS02440 (ND010_02440) - 465687..465881 (-) 195 WP_003703103.1 hypothetical protein -
  ND010_RS02445 (ND010_02445) - 466365..466583 (+) 219 WP_003691731.1 hypothetical protein -
  ND010_RS02450 (ND010_02450) - 466600..466959 (-) 360 WP_003691733.1 hypothetical protein -
  ND010_RS02455 (ND010_02455) - 466960..467499 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  ND010_RS02460 (ND010_02460) - 467659..468375 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  ND010_RS02465 (ND010_02465) - 468756..468983 (+) 228 WP_050158909.1 helix-turn-helix domain-containing protein -
  ND010_RS02470 (ND010_02470) - 468980..469117 (+) 138 WP_010359998.1 hypothetical protein -
  ND010_RS02475 (ND010_02475) - 469101..470099 (+) 999 WP_050161100.1 hypothetical protein -
  ND010_RS02480 (ND010_02480) - 470096..471457 (+) 1362 WP_260236895.1 DnaB-like helicase C-terminal domain-containing protein -
  ND010_RS02485 (ND010_02485) - 471474..471719 (+) 246 WP_260245438.1 hypothetical protein -
  ND010_RS02490 (ND010_02490) - 471794..472288 (+) 495 WP_260236897.1 DUF3310 domain-containing protein -
  ND010_RS02495 (ND010_02495) - 472486..472635 (+) 150 WP_003692854.1 hypothetical protein -
  ND010_RS02500 (ND010_02500) - 472664..472945 (+) 282 WP_229691900.1 hypothetical protein -
  ND010_RS02505 (ND010_02505) - 472936..473370 (+) 435 WP_260245439.1 RusA family crossover junction endodeoxyribonuclease -
  ND010_RS02510 (ND010_02510) - 473363..473668 (+) 306 WP_053015205.1 DUF1364 domain-containing protein -
  ND010_RS02515 (ND010_02515) - 473665..474048 (+) 384 WP_003687982.1 recombination protein NinB -
  ND010_RS02520 (ND010_02520) - 474039..474557 (+) 519 WP_003687984.1 HNH endonuclease -
  ND010_RS02525 (ND010_02525) - 474622..475044 (+) 423 WP_003690919.1 hypothetical protein -
  ND010_RS02530 (ND010_02530) - 475044..475583 (+) 540 WP_003693457.1 hypothetical protein -
  ND010_RS02535 (ND010_02535) - 475564..476838 (+) 1275 WP_311201960.1 PBSX family phage terminase large subunit -
  ND010_RS02540 (ND010_02540) - 476823..479090 (+) 2268 WP_225577699.1 hypothetical protein -
  ND010_RS02545 (ND010_02545) - 479330..479854 (+) 525 WP_260236900.1 hypothetical protein -
  ND010_RS02550 (ND010_02550) - 479851..480525 (+) 675 WP_260236901.1 hypothetical protein -
  ND010_RS02555 (ND010_02555) - 480522..488276 (+) 7755 WP_260236902.1 PLxRFG domain-containing protein -
  ND010_RS02560 (ND010_02560) - 488374..488781 (+) 408 WP_082298808.1 hypothetical protein -
  ND010_RS02565 (ND010_02565) - 488792..489217 (+) 426 WP_106336882.1 hypothetical protein -
  ND010_RS02570 (ND010_02570) - 489210..490097 (+) 888 WP_082298758.1 hypothetical protein -
  ND010_RS02575 (ND010_02575) - 490097..490477 (+) 381 WP_082298757.1 hypothetical protein -
  ND010_RS02580 (ND010_02580) - 490480..493686 (+) 3207 WP_260236903.1 hypothetical protein -
  ND010_RS02585 (ND010_02585) - 493674..494867 (+) 1194 WP_134921505.1 hypothetical protein -
  ND010_RS02590 (ND010_02590) - 494952..495851 (+) 900 WP_260236904.1 hypothetical protein -
  ND010_RS02600 (ND010_02600) - 495872..497167 (+) 1296 Protein_505 DUF4043 family protein -
  ND010_RS02605 (ND010_02605) - 497226..497699 (+) 474 WP_003693439.1 hypothetical protein -
  ND010_RS02610 (ND010_02610) - 497705..498190 (+) 486 WP_003693438.1 hypothetical protein -
  ND010_RS02615 (ND010_02615) - 498187..498861 (+) 675 WP_003693436.1 hypothetical protein -
  ND010_RS02620 (ND010_02620) - 498864..499013 (+) 150 WP_017146863.1 hypothetical protein -
  ND010_RS02625 (ND010_02625) - 499050..499901 (-) 852 WP_106336892.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 202 a.a.        Molecular weight: 21884.77 Da        Isoelectric Point: 8.4516

>NTDB_id=735907 ND010_RS02345 WP_215318018.1 453797..454405(+) (pilK) [Neisseria gonorrhoeae strain 9464]
MRKQNTLTGIPTSDGQRGSALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCGKGLCTAVNVRTNNANEESFGNIVVQSTPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYKKGTASVSKMPR
YIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 609 bp        

>NTDB_id=735907 ND010_RS02345 WP_215318018.1 453797..454405(+) (pilK) [Neisseria gonorrhoeae strain 9464]
ATGCGCAAACAGAACACTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTCCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGGAAAAGGCCTGTGTACCGCAGTGAATGTACGGACAAATAATGCTAATGA
AGAGTCTTTTGGCAATATCGTGGTGCAAAGCACGCCCACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTGGCA
AAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATAAGAAAGGCACGGCAAGCGTCAGCAAAATGCCGCGC
TATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGCCAA
TACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

94.581

100

0.95