Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | LLE39_RS02360 | Genome accession | NZ_CP106819 |
| Coordinates | 454353..454826 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10791 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440023..506437 | 454353..454826 | within | 0 |
Gene organization within MGE regions
Location: 440023..506437
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE39_RS02285 (LLE39_02285) | - | 440023..441006 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| LLE39_RS02290 (LLE39_02290) | - | 441073..441645 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| LLE39_RS02295 (LLE39_02295) | - | 441771..442940 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| LLE39_RS02300 (LLE39_02300) | ilvA | 443089..444615 (+) | 1527 | WP_003687904.1 | threonine ammonia-lyase, biosynthetic | - |
| LLE39_RS02305 (LLE39_02305) | - | 444671..445747 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE39_RS02310 (LLE39_02310) | cysW | 445744..446604 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE39_RS02315 (LLE39_02315) | cysT | 446793..447620 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE39_RS02320 (LLE39_02320) | - | 447801..448133 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE39_RS02325 (LLE39_02325) | - | 448460..448969 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE39_RS02330 (LLE39_02330) | - | 449201..449782 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE39_RS02335 (LLE39_02335) | dnaB | 449946..451352 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE39_RS02340 (LLE39_02340) | pilH | 451506..452171 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE39_RS02345 (LLE39_02345) | pilV | 452203..452814 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE39_RS02350 (LLE39_02350) | pilJ | 452811..453761 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| LLE39_RS02355 (LLE39_02355) | pilK | 453740..454351 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE39_RS02360 (LLE39_02360) | pilL | 454353..454826 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE39_RS02365 (LLE39_02365) | - | 454896..455204 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE39_RS02370 (LLE39_02370) | - | 455201..455911 (-) | 711 | Protein_465 | AzlC family ABC transporter permease | - |
| LLE39_RS02375 (LLE39_02375) | dut | 456077..456529 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE39_RS02380 (LLE39_02380) | dapC | 456605..457792 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE39_RS02385 (LLE39_02385) | yaaA | 457948..458727 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE39_RS02400 (LLE39_02400) | - | 459257..460450 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE39_RS02405 (LLE39_02405) | - | 460806..461075 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE39_RS02410 (LLE39_02410) | - | 461270..461953 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE39_RS11765 | - | 462234..462500 (-) | 267 | Protein_472 | hypothetical protein | - |
| LLE39_RS02420 (LLE39_02420) | - | 462611..462826 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE39_RS02425 (LLE39_02425) | - | 462878..463369 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE39_RS02430 (LLE39_02430) | - | 463366..463548 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE39_RS02435 (LLE39_02435) | - | 463688..464374 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE39_RS02440 (LLE39_02440) | - | 464443..464604 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| LLE39_RS02445 (LLE39_02445) | - | 464601..464879 (-) | 279 | WP_229930232.1 | NGO1622 family putative holin | - |
| LLE39_RS02450 (LLE39_02450) | - | 465032..465364 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE39_RS02455 (LLE39_02455) | - | 465506..465781 (-) | 276 | WP_082285043.1 | hypothetical protein | - |
| LLE39_RS02460 (LLE39_02460) | - | 465778..466254 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE39_RS02465 (LLE39_02465) | - | 466287..466487 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE39_RS02470 (LLE39_02470) | - | 466971..467189 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| LLE39_RS02475 (LLE39_02475) | - | 467206..467565 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| LLE39_RS02480 (LLE39_02480) | - | 467566..468105 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| LLE39_RS02485 (LLE39_02485) | - | 468265..468981 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| LLE39_RS02490 (LLE39_02490) | - | 469362..469589 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE39_RS02495 (LLE39_02495) | - | 469707..470771 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| LLE39_RS02500 (LLE39_02500) | - | 470768..472129 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE39_RS02505 (LLE39_02505) | - | 472146..472376 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| LLE39_RS02510 (LLE39_02510) | - | 472468..472962 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| LLE39_RS02515 (LLE39_02515) | - | 473139..473288 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| LLE39_RS02520 (LLE39_02520) | - | 473316..473597 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE39_RS02525 (LLE39_02525) | - | 473588..473968 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE39_RS02530 (LLE39_02530) | - | 474235..474642 (+) | 408 | WP_003691430.1 | hypothetical protein | - |
| LLE39_RS02535 (LLE39_02535) | - | 474733..475893 (+) | 1161 | WP_003691428.1 | type I restriction endonuclease | - |
| LLE39_RS02540 (LLE39_02540) | - | 476175..477044 (+) | 870 | WP_003700071.1 | BRO family protein | - |
| LLE39_RS02545 (LLE39_02545) | - | 477337..477786 (+) | 450 | WP_003689093.1 | hypothetical protein | - |
| LLE39_RS02550 (LLE39_02550) | terL | 477848..479269 (+) | 1422 | WP_003697216.1 | phage terminase large subunit | - |
| LLE39_RS02555 (LLE39_02555) | - | 479266..481413 (+) | 2148 | WP_003691423.1 | phage portal protein | - |
| LLE39_RS02560 (LLE39_02560) | - | 481481..482638 (+) | 1158 | WP_003700068.1 | hypothetical protein | - |
| LLE39_RS02565 (LLE39_02565) | - | 482679..484178 (+) | 1500 | WP_003691419.1 | hypothetical protein | - |
| LLE39_RS02570 (LLE39_02570) | - | 484185..484547 (+) | 363 | WP_003689082.1 | hypothetical protein | - |
| LLE39_RS02575 (LLE39_02575) | - | 484550..485080 (+) | 531 | WP_003689080.1 | head-tail connector protein | - |
| LLE39_RS02580 (LLE39_02580) | - | 485080..485562 (+) | 483 | WP_003706029.1 | HK97 gp10 family phage protein | - |
| LLE39_RS02585 (LLE39_02585) | - | 485559..485987 (+) | 429 | WP_003697213.1 | hypothetical protein | - |
| LLE39_RS02590 (LLE39_02590) | - | 486013..486786 (+) | 774 | WP_003691416.1 | hypothetical protein | - |
| LLE39_RS02595 (LLE39_02595) | - | 486848..487177 (+) | 330 | WP_003689072.1 | hypothetical protein | - |
| LLE39_RS02600 (LLE39_02600) | - | 487189..487455 (+) | 267 | WP_003692873.1 | hypothetical protein | - |
| LLE39_RS02605 (LLE39_02605) | - | 487455..488054 (+) | 600 | WP_003692874.1 | DUF2460 domain-containing protein | - |
| LLE39_RS02610 (LLE39_02610) | - | 488051..488905 (+) | 855 | WP_003698614.1 | DUF2163 domain-containing protein | - |
| LLE39_RS02615 (LLE39_02615) | - | 488907..489338 (+) | 432 | WP_003689064.1 | NlpC/P60 family protein | - |
| LLE39_RS02620 (LLE39_02620) | - | 489366..489644 (-) | 279 | WP_229930233.1 | helix-turn-helix domain-containing protein | - |
| LLE39_RS02625 (LLE39_02625) | - | 489884..494030 (+) | 4147 | Protein_514 | phage tail protein | - |
| LLE39_RS02635 (LLE39_02635) | - | 494142..494447 (+) | 306 | WP_003689058.1 | hypothetical protein | - |
| LLE39_RS02640 (LLE39_02640) | - | 494518..494988 (+) | 471 | WP_025455988.1 | hypothetical protein | - |
| LLE39_RS02645 (LLE39_02645) | - | 494989..495321 (+) | 333 | WP_003691408.1 | hypothetical protein | - |
| LLE39_RS02650 (LLE39_02650) | - | 495689..496036 (-) | 348 | WP_003689051.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
| LLE39_RS02655 (LLE39_02655) | - | 496036..496272 (-) | 237 | WP_003689049.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| LLE39_RS02660 (LLE39_02660) | - | 496479..497018 (+) | 540 | WP_047951643.1 | TIGR02594 family protein | - |
| LLE39_RS02665 (LLE39_02665) | - | 497018..497176 (+) | 159 | WP_003691816.1 | hypothetical protein | - |
| LLE39_RS02670 (LLE39_02670) | - | 497160..497501 (+) | 342 | WP_003696082.1 | hypothetical protein | - |
| LLE39_RS02675 (LLE39_02675) | - | 497485..497658 (+) | 174 | WP_003705498.1 | hypothetical protein | - |
| LLE39_RS02680 (LLE39_02680) | - | 497970..498119 (+) | 150 | WP_003691402.1 | hypothetical protein | - |
| LLE39_RS02685 (LLE39_02685) | - | 498149..501193 (+) | 3045 | WP_229930235.1 | tape measure protein | - |
| LLE39_RS02690 (LLE39_02690) | - | 501253..501732 (-) | 480 | WP_002241413.1 | DUF4760 domain-containing protein | - |
| LLE39_RS02695 (LLE39_02695) | - | 502074..503063 (-) | 990 | WP_003689040.1 | site-specific integrase | - |
| LLE39_RS02700 (LLE39_02700) | purM | 503752..504786 (+) | 1035 | WP_003692893.1 | phosphoribosylformylglycinamidine cyclo-ligase | - |
| LLE39_RS02705 (LLE39_02705) | - | 505784..506437 (+) | 654 | WP_134994130.1 | IS1595 family transposase | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=735762 LLE39_RS02360 WP_172760650.1 454353..454826(+) (pilL) [Neisseria gonorrhoeae strain 10791]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=735762 LLE39_RS02360 WP_172760650.1 454353..454826(+) (pilL) [Neisseria gonorrhoeae strain 10791]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |