Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilJ   Type   Machinery gene
Locus tag   LLE39_RS02350 Genome accession   NZ_CP106819
Coordinates   452811..453761 (+) Length   316 a.a.
NCBI ID   WP_003699627.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10791     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 440023..506437 452811..453761 within 0


Gene organization within MGE regions


Location: 440023..506437
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLE39_RS02285 (LLE39_02285) - 440023..441006 (+) 984 WP_003687900.1 ribose-phosphate pyrophosphokinase -
  LLE39_RS02290 (LLE39_02290) - 441073..441645 (+) 573 WP_003687901.1 50S ribosomal protein L25/general stress protein Ctc -
  LLE39_RS02295 (LLE39_02295) - 441771..442940 (-) 1170 WP_003687902.1 D-alanyl-D-alanine carboxypeptidase family protein -
  LLE39_RS02300 (LLE39_02300) ilvA 443089..444615 (+) 1527 WP_003687904.1 threonine ammonia-lyase, biosynthetic -
  LLE39_RS02305 (LLE39_02305) - 444671..445747 (-) 1077 WP_003692814.1 sulfate/molybdate ABC transporter ATP-binding protein -
  LLE39_RS02310 (LLE39_02310) cysW 445744..446604 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  LLE39_RS02315 (LLE39_02315) cysT 446793..447620 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  LLE39_RS02320 (LLE39_02320) - 447801..448133 (+) 333 WP_003687908.1 hypothetical protein -
  LLE39_RS02325 (LLE39_02325) - 448460..448969 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  LLE39_RS02330 (LLE39_02330) - 449201..449782 (-) 582 WP_003690895.1 superoxide dismutase -
  LLE39_RS02335 (LLE39_02335) dnaB 449946..451352 (+) 1407 WP_003699622.1 replicative DNA helicase -
  LLE39_RS02340 (LLE39_02340) pilH 451506..452171 (+) 666 WP_003699624.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  LLE39_RS02345 (LLE39_02345) pilV 452203..452814 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  LLE39_RS02350 (LLE39_02350) pilJ 452811..453761 (+) 951 WP_003699627.1 PilW family protein Machinery gene
  LLE39_RS02355 (LLE39_02355) pilK 453740..454351 (+) 612 WP_033911077.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  LLE39_RS02360 (LLE39_02360) pilL 454353..454826 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  LLE39_RS02365 (LLE39_02365) - 454896..455204 (-) 309 WP_025456177.1 AzlD family protein -
  LLE39_RS02370 (LLE39_02370) - 455201..455911 (-) 711 Protein_465 AzlC family ABC transporter permease -
  LLE39_RS02375 (LLE39_02375) dut 456077..456529 (+) 453 WP_003699637.1 dUTP diphosphatase -
  LLE39_RS02380 (LLE39_02380) dapC 456605..457792 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  LLE39_RS02385 (LLE39_02385) yaaA 457948..458727 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  LLE39_RS02400 (LLE39_02400) - 459257..460450 (+) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  LLE39_RS02405 (LLE39_02405) - 460806..461075 (-) 270 WP_003687928.1 hypothetical protein -
  LLE39_RS02410 (LLE39_02410) - 461270..461953 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  LLE39_RS11765 - 462234..462500 (-) 267 Protein_472 hypothetical protein -
  LLE39_RS02420 (LLE39_02420) - 462611..462826 (-) 216 WP_003691538.1 hypothetical protein -
  LLE39_RS02425 (LLE39_02425) - 462878..463369 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  LLE39_RS02430 (LLE39_02430) - 463366..463548 (-) 183 WP_003691535.1 hypothetical protein -
  LLE39_RS02435 (LLE39_02435) - 463688..464374 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  LLE39_RS02440 (LLE39_02440) - 464443..464604 (-) 162 WP_003693867.1 hypothetical protein -
  LLE39_RS02445 (LLE39_02445) - 464601..464879 (-) 279 WP_229930232.1 NGO1622 family putative holin -
  LLE39_RS02450 (LLE39_02450) - 465032..465364 (-) 333 WP_003695500.1 hypothetical protein -
  LLE39_RS02455 (LLE39_02455) - 465506..465781 (-) 276 WP_082285043.1 hypothetical protein -
  LLE39_RS02460 (LLE39_02460) - 465778..466254 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  LLE39_RS02465 (LLE39_02465) - 466287..466487 (-) 201 WP_003692842.1 hypothetical protein -
  LLE39_RS02470 (LLE39_02470) - 466971..467189 (+) 219 WP_003691731.1 hypothetical protein -
  LLE39_RS02475 (LLE39_02475) - 467206..467565 (-) 360 WP_003691733.1 hypothetical protein -
  LLE39_RS02480 (LLE39_02480) - 467566..468105 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  LLE39_RS02485 (LLE39_02485) - 468265..468981 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  LLE39_RS02490 (LLE39_02490) - 469362..469589 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  LLE39_RS02495 (LLE39_02495) - 469707..470771 (+) 1065 WP_003689134.1 hypothetical protein -
  LLE39_RS02500 (LLE39_02500) - 470768..472129 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  LLE39_RS02505 (LLE39_02505) - 472146..472376 (+) 231 WP_012503490.1 hypothetical protein -
  LLE39_RS02510 (LLE39_02510) - 472468..472962 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  LLE39_RS02515 (LLE39_02515) - 473139..473288 (+) 150 WP_003689110.1 hypothetical protein -
  LLE39_RS02520 (LLE39_02520) - 473316..473597 (+) 282 WP_003689109.1 hypothetical protein -
  LLE39_RS02525 (LLE39_02525) - 473588..473968 (+) 381 WP_033911195.1 RusA family crossover junction endodeoxyribonuclease -
  LLE39_RS02530 (LLE39_02530) - 474235..474642 (+) 408 WP_003691430.1 hypothetical protein -
  LLE39_RS02535 (LLE39_02535) - 474733..475893 (+) 1161 WP_003691428.1 type I restriction endonuclease -
  LLE39_RS02540 (LLE39_02540) - 476175..477044 (+) 870 WP_003700071.1 BRO family protein -
  LLE39_RS02545 (LLE39_02545) - 477337..477786 (+) 450 WP_003689093.1 hypothetical protein -
  LLE39_RS02550 (LLE39_02550) terL 477848..479269 (+) 1422 WP_003697216.1 phage terminase large subunit -
  LLE39_RS02555 (LLE39_02555) - 479266..481413 (+) 2148 WP_003691423.1 phage portal protein -
  LLE39_RS02560 (LLE39_02560) - 481481..482638 (+) 1158 WP_003700068.1 hypothetical protein -
  LLE39_RS02565 (LLE39_02565) - 482679..484178 (+) 1500 WP_003691419.1 hypothetical protein -
  LLE39_RS02570 (LLE39_02570) - 484185..484547 (+) 363 WP_003689082.1 hypothetical protein -
  LLE39_RS02575 (LLE39_02575) - 484550..485080 (+) 531 WP_003689080.1 head-tail connector protein -
  LLE39_RS02580 (LLE39_02580) - 485080..485562 (+) 483 WP_003706029.1 HK97 gp10 family phage protein -
  LLE39_RS02585 (LLE39_02585) - 485559..485987 (+) 429 WP_003697213.1 hypothetical protein -
  LLE39_RS02590 (LLE39_02590) - 486013..486786 (+) 774 WP_003691416.1 hypothetical protein -
  LLE39_RS02595 (LLE39_02595) - 486848..487177 (+) 330 WP_003689072.1 hypothetical protein -
  LLE39_RS02600 (LLE39_02600) - 487189..487455 (+) 267 WP_003692873.1 hypothetical protein -
  LLE39_RS02605 (LLE39_02605) - 487455..488054 (+) 600 WP_003692874.1 DUF2460 domain-containing protein -
  LLE39_RS02610 (LLE39_02610) - 488051..488905 (+) 855 WP_003698614.1 DUF2163 domain-containing protein -
  LLE39_RS02615 (LLE39_02615) - 488907..489338 (+) 432 WP_003689064.1 NlpC/P60 family protein -
  LLE39_RS02620 (LLE39_02620) - 489366..489644 (-) 279 WP_229930233.1 helix-turn-helix domain-containing protein -
  LLE39_RS02625 (LLE39_02625) - 489884..494030 (+) 4147 Protein_514 phage tail protein -
  LLE39_RS02635 (LLE39_02635) - 494142..494447 (+) 306 WP_003689058.1 hypothetical protein -
  LLE39_RS02640 (LLE39_02640) - 494518..494988 (+) 471 WP_025455988.1 hypothetical protein -
  LLE39_RS02645 (LLE39_02645) - 494989..495321 (+) 333 WP_003691408.1 hypothetical protein -
  LLE39_RS02650 (LLE39_02650) - 495689..496036 (-) 348 WP_003689051.1 type II toxin-antitoxin system PemK/MazF family toxin -
  LLE39_RS02655 (LLE39_02655) - 496036..496272 (-) 237 WP_003689049.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
  LLE39_RS02660 (LLE39_02660) - 496479..497018 (+) 540 WP_047951643.1 TIGR02594 family protein -
  LLE39_RS02665 (LLE39_02665) - 497018..497176 (+) 159 WP_003691816.1 hypothetical protein -
  LLE39_RS02670 (LLE39_02670) - 497160..497501 (+) 342 WP_003696082.1 hypothetical protein -
  LLE39_RS02675 (LLE39_02675) - 497485..497658 (+) 174 WP_003705498.1 hypothetical protein -
  LLE39_RS02680 (LLE39_02680) - 497970..498119 (+) 150 WP_003691402.1 hypothetical protein -
  LLE39_RS02685 (LLE39_02685) - 498149..501193 (+) 3045 WP_229930235.1 tape measure protein -
  LLE39_RS02690 (LLE39_02690) - 501253..501732 (-) 480 WP_002241413.1 DUF4760 domain-containing protein -
  LLE39_RS02695 (LLE39_02695) - 502074..503063 (-) 990 WP_003689040.1 site-specific integrase -
  LLE39_RS02700 (LLE39_02700) purM 503752..504786 (+) 1035 WP_003692893.1 phosphoribosylformylglycinamidine cyclo-ligase -
  LLE39_RS02705 (LLE39_02705) - 505784..506437 (+) 654 WP_134994130.1 IS1595 family transposase -

Sequence


Protein


Download         Length: 316 a.a.        Molecular weight: 34788.50 Da        Isoelectric Point: 9.1777

>NTDB_id=735760 LLE39_RS02350 WP_003699627.1 452811..453761(+) (pilJ) [Neisseria gonorrhoeae strain 10791]
MKRKMLNVPKGGYDGMKGFTIVEFLVAGLLSVIVLIAVVSSYFTSRKLNDAANERLAEQQDLRNAATLIVRDARMAGSFG
CFNMSEHTGNDVVSNVAQKNALFYLKRNSTNSTNSTNKLIPITESPNINYQKFFQVSSALIFQYGIDDVNASAATTVVSS
CAAISKPGKQIPTLEDAKKELKIVSQDKEQNGNIARQRHVVNAYAVGRIADEQGLFRFQLNEKGEWGNPQLLAKKIKRMR
VRYIYVSDCPEDEDAGKEEQFKYTDKFDSSVTPAGVEVLLDSGGDAKIAASSDNIIYAYRINATIRGGNVCANRTL

Nucleotide


Download         Length: 951 bp        

>NTDB_id=735760 LLE39_RS02350 WP_003699627.1 452811..453761(+) (pilJ) [Neisseria gonorrhoeae strain 10791]
ATGAAACGTAAAATGCTAAACGTACCAAAGGGCGGTTATGATGGTATGAAGGGTTTTACCATTGTTGAATTTCTGGTTGC
GGGCCTGCTCAGTGTGATTGTCCTGATAGCGGTCGTATCGAGTTACTTTACATCCCGGAAATTAAATGATGCGGCAAACG
AGCGTCTTGCCGAGCAACAGGATTTGCGGAATGCGGCAACATTGATTGTCCGCGATGCAAGAATGGCGGGGAGCTTCGGT
TGTTTCAATATGTCTGAGCATACCGGAAATGATGTTGTTTCCAATGTGGCGCAAAAAAACGCTCTTTTTTACTTAAAAAG
GAACAGTACAAACAGTACAAACAGTACAAATAAACTTATCCCCATAACGGAATCTCCAAATATCAATTATCAGAAATTTT
TCCAGGTTAGTAGCGCATTGATTTTTCAATACGGAATCGATGATGTTAATGCAAGCGCCGCGACTACCGTCGTCAGCAGC
TGTGCCGCAATATCGAAACCGGGCAAGCAAATCCCTACTTTAGAAGATGCAAAAAAAGAATTGAAGATTGTGAGTCAGGA
TAAGGAGCAAAATGGCAATATAGCGCGTCAAAGGCATGTGGTCAATGCCTATGCGGTCGGCAGGATTGCCGATGAGCAAG
GTTTGTTCCGCTTCCAATTGAATGAAAAGGGTGAGTGGGGTAATCCTCAGTTGCTCGCGAAAAAGATTAAACGTATGAGA
GTGCGGTATATCTATGTTTCCGATTGTCCTGAAGATGAAGATGCCGGCAAAGAGGAACAATTCAAATATACGGATAAATT
CGACAGCTCTGTTACGCCTGCCGGGGTGGAGGTTTTATTGGATAGCGGTGGTGATGCCAAGATTGCCGCTTCTTCAGATA
ATATTATTTATGCTTACCGTATCAATGCGACAATACGCGGGGGAAATGTATGCGCAAACAGAACGCTTTGA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilJ Neisseria gonorrhoeae MS11

93.038

100

0.93