Detailed information
Bioinformatically predicted
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | LLE36_RS02350 | Genome accession | NZ_CP106817 |
| Coordinates | 453864..454337 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10574 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444182..493037 | 453864..454337 | within | 0 |
Gene organization within MGE regions
Location: 444182..493037
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE36_RS02295 (LLE36_02295) | - | 444182..445258 (-) | 1077 | WP_229931480.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE36_RS02300 (LLE36_02300) | cysW | 445255..446115 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE36_RS02305 (LLE36_02305) | cysT | 446304..447131 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE36_RS02310 (LLE36_02310) | - | 447312..447644 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE36_RS02315 (LLE36_02315) | - | 447971..448480 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE36_RS02320 (LLE36_02320) | - | 448712..449293 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE36_RS02325 (LLE36_02325) | dnaB | 449457..450863 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE36_RS02330 (LLE36_02330) | pilH | 451017..451682 (+) | 666 | WP_229931479.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE36_RS02335 (LLE36_02335) | pilV | 451714..452325 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE36_RS02340 (LLE36_02340) | pilJ | 452322..453272 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| LLE36_RS02345 (LLE36_02345) | pilK | 453251..453862 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE36_RS02350 (LLE36_02350) | pilL | 453864..454337 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE36_RS02355 (LLE36_02355) | - | 454407..454715 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE36_RS02360 (LLE36_02360) | - | 454712..455422 (-) | 711 | Protein_463 | AzlC family ABC transporter permease | - |
| LLE36_RS02365 (LLE36_02365) | dut | 455588..456040 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE36_RS02370 (LLE36_02370) | dapC | 456116..457303 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE36_RS02375 (LLE36_02375) | yaaA | 457459..458238 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE36_RS02390 (LLE36_02390) | - | 458768..459961 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE36_RS02395 (LLE36_02395) | - | 460317..460586 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE36_RS02400 (LLE36_02400) | - | 460781..461464 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE36_RS11770 | - | 461745..462011 (-) | 267 | Protein_470 | hypothetical protein | - |
| LLE36_RS02410 (LLE36_02410) | - | 462122..462337 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE36_RS02415 (LLE36_02415) | - | 462389..462880 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE36_RS02420 (LLE36_02420) | - | 462877..463059 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE36_RS02425 (LLE36_02425) | - | 463199..463885 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE36_RS02430 (LLE36_02430) | - | 463954..464115 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE36_RS02435 (LLE36_02435) | - | 464112..464387 (-) | 276 | WP_033911205.1 | NGO1622 family putative holin | - |
| LLE36_RS02440 (LLE36_02440) | - | 464540..464872 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE36_RS02445 (LLE36_02445) | - | 465014..465307 (-) | 294 | WP_229931463.1 | hypothetical protein | - |
| LLE36_RS02450 (LLE36_02450) | - | 465304..465780 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE36_RS02455 (LLE36_02455) | - | 465813..466013 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE36_RS02460 (LLE36_02460) | - | 466211..466624 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| LLE36_RS02465 (LLE36_02465) | - | 466621..467082 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| LLE36_RS02470 (LLE36_02470) | - | 467099..467536 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| LLE36_RS02475 (LLE36_02475) | - | 467649..468365 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| LLE36_RS02480 (LLE36_02480) | - | 468440..468670 (+) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| LLE36_RS02485 (LLE36_02485) | - | 468750..468905 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE36_RS02490 (LLE36_02490) | - | 468882..469070 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE36_RS02495 (LLE36_02495) | - | 469243..469470 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE36_RS02500 (LLE36_02500) | - | 469588..470055 (+) | 468 | WP_229692802.1 | hypothetical protein | - |
| LLE36_RS02505 (LLE36_02505) | - | 470150..470653 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| LLE36_RS02510 (LLE36_02510) | - | 470650..472011 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE36_RS02515 (LLE36_02515) | - | 472028..472258 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| LLE36_RS02520 (LLE36_02520) | - | 472350..472844 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| LLE36_RS02525 (LLE36_02525) | - | 473039..473188 (+) | 150 | WP_003689110.1 | hypothetical protein | - |
| LLE36_RS02530 (LLE36_02530) | - | 473216..473497 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE36_RS02535 (LLE36_02535) | - | 473488..473925 (+) | 438 | WP_229433529.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE36_RS02540 (LLE36_02540) | - | 473918..474223 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| LLE36_RS02545 (LLE36_02545) | - | 474220..474603 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| LLE36_RS02550 (LLE36_02550) | - | 474594..475112 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| LLE36_RS02555 (LLE36_02555) | - | 475177..475599 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| LLE36_RS02560 (LLE36_02560) | - | 475599..476138 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| LLE36_RS02565 (LLE36_02565) | - | 476119..477393 (+) | 1275 | WP_309491694.1 | PBSX family phage terminase large subunit | - |
| LLE36_RS02570 (LLE36_02570) | - | 477378..479645 (+) | 2268 | WP_229433533.1 | hypothetical protein | - |
| LLE36_RS02575 (LLE36_02575) | - | 479865..481079 (+) | 1215 | WP_017146865.1 | hypothetical protein | - |
| LLE36_RS02580 (LLE36_02580) | - | 481076..488383 (+) | 7308 | WP_229931478.1 | PLxRFG domain-containing protein | - |
| LLE36_RS02585 (LLE36_02585) | - | 489009..490304 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| LLE36_RS02590 (LLE36_02590) | - | 490362..490835 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| LLE36_RS02595 (LLE36_02595) | - | 490841..491326 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| LLE36_RS02600 (LLE36_02600) | - | 491323..491997 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| LLE36_RS02605 (LLE36_02605) | - | 492000..492149 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| LLE36_RS02610 (LLE36_02610) | - | 492186..493037 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=735715 LLE36_RS02350 WP_172760650.1 453864..454337(+) (pilL) [Neisseria gonorrhoeae strain 10574]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=735715 LLE36_RS02350 WP_172760650.1 453864..454337(+) (pilL) [Neisseria gonorrhoeae strain 10574]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |