Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilK   Type   Machinery gene
Locus tag   LLE36_RS02345 Genome accession   NZ_CP106817
Coordinates   453251..453862 (+) Length   203 a.a.
NCBI ID   WP_033911077.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10574     
Function   type IV pilus (predicted from homology)   
DNA binding and uptake

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 444182..493037 453251..453862 within 0


Gene organization within MGE regions


Location: 444182..493037
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  LLE36_RS02295 (LLE36_02295) - 444182..445258 (-) 1077 WP_229931480.1 sulfate/molybdate ABC transporter ATP-binding protein -
  LLE36_RS02300 (LLE36_02300) cysW 445255..446115 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  LLE36_RS02305 (LLE36_02305) cysT 446304..447131 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  LLE36_RS02310 (LLE36_02310) - 447312..447644 (+) 333 WP_003687908.1 hypothetical protein -
  LLE36_RS02315 (LLE36_02315) - 447971..448480 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  LLE36_RS02320 (LLE36_02320) - 448712..449293 (-) 582 WP_003690895.1 superoxide dismutase -
  LLE36_RS02325 (LLE36_02325) dnaB 449457..450863 (+) 1407 WP_003699622.1 replicative DNA helicase -
  LLE36_RS02330 (LLE36_02330) pilH 451017..451682 (+) 666 WP_229931479.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  LLE36_RS02335 (LLE36_02335) pilV 451714..452325 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  LLE36_RS02340 (LLE36_02340) pilJ 452322..453272 (+) 951 WP_003699627.1 PilW family protein Machinery gene
  LLE36_RS02345 (LLE36_02345) pilK 453251..453862 (+) 612 WP_033911077.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  LLE36_RS02350 (LLE36_02350) pilL 453864..454337 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  LLE36_RS02355 (LLE36_02355) - 454407..454715 (-) 309 WP_025456177.1 AzlD family protein -
  LLE36_RS02360 (LLE36_02360) - 454712..455422 (-) 711 Protein_463 AzlC family ABC transporter permease -
  LLE36_RS02365 (LLE36_02365) dut 455588..456040 (+) 453 WP_003699637.1 dUTP diphosphatase -
  LLE36_RS02370 (LLE36_02370) dapC 456116..457303 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  LLE36_RS02375 (LLE36_02375) yaaA 457459..458238 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  LLE36_RS02390 (LLE36_02390) - 458768..459961 (+) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  LLE36_RS02395 (LLE36_02395) - 460317..460586 (-) 270 WP_003687928.1 hypothetical protein -
  LLE36_RS02400 (LLE36_02400) - 460781..461464 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  LLE36_RS11770 - 461745..462011 (-) 267 Protein_470 hypothetical protein -
  LLE36_RS02410 (LLE36_02410) - 462122..462337 (-) 216 WP_003691538.1 hypothetical protein -
  LLE36_RS02415 (LLE36_02415) - 462389..462880 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  LLE36_RS02420 (LLE36_02420) - 462877..463059 (-) 183 WP_003691535.1 hypothetical protein -
  LLE36_RS02425 (LLE36_02425) - 463199..463885 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  LLE36_RS02430 (LLE36_02430) - 463954..464115 (-) 162 WP_003691530.1 hypothetical protein -
  LLE36_RS02435 (LLE36_02435) - 464112..464387 (-) 276 WP_033911205.1 NGO1622 family putative holin -
  LLE36_RS02440 (LLE36_02440) - 464540..464872 (-) 333 WP_003695500.1 hypothetical protein -
  LLE36_RS02445 (LLE36_02445) - 465014..465307 (-) 294 WP_229931463.1 hypothetical protein -
  LLE36_RS02450 (LLE36_02450) - 465304..465780 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  LLE36_RS02455 (LLE36_02455) - 465813..466013 (-) 201 WP_003692842.1 hypothetical protein -
  LLE36_RS02460 (LLE36_02460) - 466211..466624 (-) 414 WP_003687963.1 hypothetical protein -
  LLE36_RS02465 (LLE36_02465) - 466621..467082 (-) 462 WP_003687965.1 helix-turn-helix domain-containing protein -
  LLE36_RS02470 (LLE36_02470) - 467099..467536 (-) 438 WP_003687967.1 hypothetical protein -
  LLE36_RS02475 (LLE36_02475) - 467649..468365 (-) 717 WP_003687969.1 LexA family transcriptional regulator -
  LLE36_RS02480 (LLE36_02480) - 468440..468670 (+) 231 WP_020997318.1 Cro/CI family transcriptional regulator -
  LLE36_RS02485 (LLE36_02485) - 468750..468905 (+) 156 WP_003698902.1 hypothetical protein -
  LLE36_RS02490 (LLE36_02490) - 468882..469070 (-) 189 WP_003691445.1 hypothetical protein -
  LLE36_RS02495 (LLE36_02495) - 469243..469470 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  LLE36_RS02500 (LLE36_02500) - 469588..470055 (+) 468 WP_229692802.1 hypothetical protein -
  LLE36_RS02505 (LLE36_02505) - 470150..470653 (+) 504 WP_010360005.1 hypothetical protein -
  LLE36_RS02510 (LLE36_02510) - 470650..472011 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  LLE36_RS02515 (LLE36_02515) - 472028..472258 (+) 231 WP_012503490.1 hypothetical protein -
  LLE36_RS02520 (LLE36_02520) - 472350..472844 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  LLE36_RS02525 (LLE36_02525) - 473039..473188 (+) 150 WP_003689110.1 hypothetical protein -
  LLE36_RS02530 (LLE36_02530) - 473216..473497 (+) 282 WP_003689109.1 hypothetical protein -
  LLE36_RS02535 (LLE36_02535) - 473488..473925 (+) 438 WP_229433529.1 RusA family crossover junction endodeoxyribonuclease -
  LLE36_RS02540 (LLE36_02540) - 473918..474223 (+) 306 WP_025456182.1 DUF1364 domain-containing protein -
  LLE36_RS02545 (LLE36_02545) - 474220..474603 (+) 384 WP_003699764.1 recombination protein NinB -
  LLE36_RS02550 (LLE36_02550) - 474594..475112 (+) 519 WP_003693459.1 HNH endonuclease -
  LLE36_RS02555 (LLE36_02555) - 475177..475599 (+) 423 WP_003690919.1 hypothetical protein -
  LLE36_RS02560 (LLE36_02560) - 475599..476138 (+) 540 WP_003693457.1 hypothetical protein -
  LLE36_RS02565 (LLE36_02565) - 476119..477393 (+) 1275 WP_309491694.1 PBSX family phage terminase large subunit -
  LLE36_RS02570 (LLE36_02570) - 477378..479645 (+) 2268 WP_229433533.1 hypothetical protein -
  LLE36_RS02575 (LLE36_02575) - 479865..481079 (+) 1215 WP_017146865.1 hypothetical protein -
  LLE36_RS02580 (LLE36_02580) - 481076..488383 (+) 7308 WP_229931478.1 PLxRFG domain-containing protein -
  LLE36_RS02585 (LLE36_02585) - 489009..490304 (+) 1296 WP_003693441.1 DUF4043 family protein -
  LLE36_RS02590 (LLE36_02590) - 490362..490835 (+) 474 WP_003693439.1 hypothetical protein -
  LLE36_RS02595 (LLE36_02595) - 490841..491326 (+) 486 WP_003693438.1 hypothetical protein -
  LLE36_RS02600 (LLE36_02600) - 491323..491997 (+) 675 WP_003693436.1 hypothetical protein -
  LLE36_RS02605 (LLE36_02605) - 492000..492149 (+) 150 WP_017146863.1 hypothetical protein -
  LLE36_RS02610 (LLE36_02610) - 492186..493037 (-) 852 WP_003699775.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 203 a.a.        Molecular weight: 22068.97 Da        Isoelectric Point: 7.5813

>NTDB_id=735714 LLE36_RS02345 WP_033911077.1 453251..453862(+) (pilK) [Neisseria gonorrhoeae strain 10574]
MRKQNALTGIPTSDGQRGFALFIVLMVMIVVAFLVVTAAQSYNTEQRISANESDRKLALSLAEAALREGEFQVLDLEYTA
DSKVTFSENCEKGLCTAVNVRTNNNGNEEAFGNIVVQGKPTVEAVKRSCPAKSGKNSTGLCIDNQGVEYEKGTASVSKMP
RYIIEYLGVKNGQNVYRVTAKAWGKNANTVVVLQSYVGNNDEQ

Nucleotide


Download         Length: 612 bp        

>NTDB_id=735714 LLE36_RS02345 WP_033911077.1 453251..453862(+) (pilK) [Neisseria gonorrhoeae strain 10574]
ATGCGCAAACAGAACGCTTTGACAGGAATCCCGACTTCTGACGGACAGAGGGGGTTCGCACTGTTTATCGTGCTGATGGT
GATGATAGTCGTGGCCTTTTTGGTTGTAACTGCCGCCCAGTCCTACAATACCGAACAGAGGATCAGTGCCAACGAATCAG
ACAGGAAATTGGCTTTGTCTTTAGCCGAGGCGGCTTTGAGGGAAGGCGAATTTCAGGTTTTGGATTTGGAATATACTGCG
GATAGTAAGGTTACATTTAGCGAAAACTGTGAAAAAGGTCTGTGTACCGCAGTGAATGTGCGGACAAATAATAATGGTAA
TGAAGAGGCTTTTGGCAATATCGTGGTGCAAGGCAAGCCTACCGTTGAGGCGGTGAAGCGTTCTTGCCCTGCAAAGTCTG
GCAAAAATTCTACCGGCCTGTGCATTGACAATCAGGGAGTGGAATATGAGAAAGGCACGGCAAGCGTCAGCAAAATGCCG
CGCTATATTATCGAATATTTAGGCGTGAAGAACGGACAAAATGTTTATCGGGTTACTGCCAAGGCTTGGGGTAAGAATGC
CAATACCGTGGTCGTCCTTCAATCTTATGTAGGCAATAATGATGAGCAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilK Neisseria gonorrhoeae MS11

95.567

100

0.956