Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | LLE28_RS02360 | Genome accession | NZ_CP106771 |
| Coordinates | 454484..454957 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10531 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 440154..493767 | 454484..454957 | within | 0 |
Gene organization within MGE regions
Location: 440154..493767
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE28_RS02285 | - | 440154..441137 (+) | 984 | WP_003687900.1 | ribose-phosphate pyrophosphokinase | - |
| LLE28_RS02290 | - | 441204..441776 (+) | 573 | WP_003687901.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
| LLE28_RS02295 | - | 441902..443071 (-) | 1170 | WP_003687902.1 | D-alanyl-D-alanine carboxypeptidase family protein | - |
| LLE28_RS02300 | ilvA | 443220..444746 (+) | 1527 | WP_229930545.1 | threonine ammonia-lyase, biosynthetic | - |
| LLE28_RS02305 | - | 444802..445878 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| LLE28_RS02310 | cysW | 445875..446735 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| LLE28_RS02315 | cysT | 446924..447751 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| LLE28_RS02320 | - | 447932..448264 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| LLE28_RS02325 | - | 448591..449100 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| LLE28_RS02330 | - | 449332..449913 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| LLE28_RS02335 | dnaB | 450077..451483 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| LLE28_RS02340 | pilH | 451637..452302 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| LLE28_RS02345 | pilV | 452334..452945 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| LLE28_RS02350 | pilJ | 452942..453892 (+) | 951 | WP_003699627.1 | PilW family protein | Machinery gene |
| LLE28_RS02355 | pilK | 453871..454482 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| LLE28_RS02360 | pilL | 454484..454957 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| LLE28_RS02365 | - | 455027..455335 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| LLE28_RS02370 | - | 455332..456042 (-) | 711 | Protein_465 | AzlC family ABC transporter permease | - |
| LLE28_RS02375 | dut | 456208..456660 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| LLE28_RS02380 | dapC | 456736..457923 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| LLE28_RS02385 | yaaA | 458079..458858 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| LLE28_RS02400 | - | 459388..460581 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| LLE28_RS02405 | - | 460937..461206 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| LLE28_RS02410 | - | 461401..462084 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| LLE28_RS11755 | - | 462365..462631 (-) | 267 | Protein_472 | hypothetical protein | - |
| LLE28_RS02420 | - | 462742..462957 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE28_RS02425 | - | 463009..463500 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE28_RS02430 | - | 463497..463679 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE28_RS02435 | - | 463819..464505 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE28_RS02440 | - | 464574..464735 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE28_RS02445 | - | 464732..465007 (-) | 276 | WP_033911205.1 | NGO1622 family putative holin | - |
| LLE28_RS02450 | - | 465160..465492 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE28_RS02455 | - | 465634..465909 (-) | 276 | WP_229930546.1 | hypothetical protein | - |
| LLE28_RS02460 | - | 465906..466382 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| LLE28_RS02465 | - | 466415..466615 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| LLE28_RS02470 | - | 466813..467226 (-) | 414 | WP_003687963.1 | hypothetical protein | - |
| LLE28_RS02475 | - | 467223..467684 (-) | 462 | WP_003687965.1 | helix-turn-helix domain-containing protein | - |
| LLE28_RS02480 | - | 467701..468138 (-) | 438 | WP_003687967.1 | hypothetical protein | - |
| LLE28_RS02485 | - | 468251..468967 (-) | 717 | WP_003687969.1 | LexA family transcriptional regulator | - |
| LLE28_RS02490 | - | 469042..469272 (+) | 231 | WP_020997318.1 | Cro/CI family transcriptional regulator | - |
| LLE28_RS02495 | - | 469352..469507 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE28_RS02500 | - | 469484..469672 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE28_RS02505 | - | 469845..470072 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| LLE28_RS02510 | - | 470190..470657 (+) | 468 | WP_229692802.1 | hypothetical protein | - |
| LLE28_RS02515 | - | 470752..471255 (+) | 504 | WP_010360005.1 | hypothetical protein | - |
| LLE28_RS02520 | - | 471252..472613 (+) | 1362 | WP_003706450.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| LLE28_RS02525 | - | 472630..472881 (+) | 252 | WP_003703849.1 | hypothetical protein | - |
| LLE28_RS02530 | - | 472895..473389 (+) | 495 | WP_047923539.1 | DUF3310 domain-containing protein | - |
| LLE28_RS02535 | - | 473768..473917 (+) | 150 | WP_047920329.1 | phage associated protein | - |
| LLE28_RS02540 | - | 473946..474227 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE28_RS02545 | - | 474218..474655 (+) | 438 | WP_229433529.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE28_RS02550 | - | 474648..474953 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| LLE28_RS02555 | - | 474950..475333 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| LLE28_RS02560 | - | 475324..475842 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| LLE28_RS02565 | - | 475907..476329 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| LLE28_RS02570 | - | 476329..476868 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| LLE28_RS02575 | - | 476849..478123 (+) | 1275 | WP_003698265.1 | PBSX family phage terminase large subunit | - |
| LLE28_RS02580 | - | 478108..480375 (+) | 2268 | WP_229433533.1 | hypothetical protein | - |
| LLE28_RS02585 | - | 480613..481809 (+) | 1197 | WP_003693452.1 | hypothetical protein | - |
| LLE28_RS02590 | - | 481806..489113 (+) | 7308 | WP_003698268.1 | PLxRFG domain-containing protein | - |
| LLE28_RS02595 | - | 489739..491034 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| LLE28_RS02600 | - | 491092..491565 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| LLE28_RS02605 | - | 491571..492056 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| LLE28_RS02610 | - | 492053..492727 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| LLE28_RS02615 | - | 492730..492879 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| LLE28_RS02620 | - | 492916..493767 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=734777 LLE28_RS02360 WP_172760650.1 454484..454957(+) (pilL) [Neisseria gonorrhoeae strain 10531]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=734777 LLE28_RS02360 WP_172760650.1 454484..454957(+) (pilL) [Neisseria gonorrhoeae strain 10531]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |