Detailed information
Bioinformatically predicted
Overview
| Name | comP | Type | Machinery gene |
| Locus tag | LLE33_RS08130 | Genome accession | NZ_CP106767 |
| Coordinates | 1541751..1542200 (-) | Length | 149 a.a. |
| NCBI ID | WP_002214937.1 | Uniprot ID | A0AA44U8B7 |
| Organism | Neisseria gonorrhoeae strain 10610 | ||
| Function | DNA binding; DNA uptake; receptor of DNA uptake sequence (DUS) (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| ICE | 1508217..1541502 | 1541751..1542200 | flank | 249 |
Gene organization within MGE regions
Location: 1508217..1542200
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LLE33_RS07855 (LLE33_07855) | - | 1508245..1509219 (-) | 975 | WP_003689550.1 | SIS domain-containing protein | - |
| LLE33_RS07860 (LLE33_07860) | tal | 1509316..1510371 (+) | 1056 | WP_003689551.1 | transaldolase | - |
| LLE33_RS07865 (LLE33_07865) | - | 1510383..1510517 (+) | 135 | WP_003703570.1 | hypothetical protein | - |
| LLE33_RS07870 (LLE33_07870) | - | 1510522..1510812 (+) | 291 | WP_003689553.1 | hypothetical protein | - |
| LLE33_RS07875 (LLE33_07875) | gluQRS | 1510829..1511716 (+) | 888 | WP_003693489.1 | tRNA glutamyl-Q(34) synthetase GluQRS | - |
| LLE33_RS07880 (LLE33_07880) | dusA | 1511786..1512802 (-) | 1017 | WP_003693487.1 | tRNA dihydrouridine(20/20a) synthase DusA | - |
| LLE33_RS07885 (LLE33_07885) | - | 1512922..1514076 (+) | 1155 | WP_003693486.1 | tyrosine-type recombinase/integrase | - |
| LLE33_RS07890 (LLE33_07890) | - | 1514126..1514392 (-) | 267 | WP_003689557.1 | pyocin activator PrtN family protein | - |
| LLE33_RS07895 (LLE33_07895) | - | 1514500..1515648 (-) | 1149 | WP_134994054.1 | SAM-dependent methyltransferase | - |
| LLE33_RS07900 (LLE33_07900) | - | 1515645..1516628 (-) | 984 | WP_134994057.1 | hypothetical protein | - |
| LLE33_RS07905 (LLE33_07905) | - | 1516739..1516954 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| LLE33_RS07910 (LLE33_07910) | - | 1517006..1517497 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| LLE33_RS07915 (LLE33_07915) | - | 1517494..1517676 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| LLE33_RS07920 (LLE33_07920) | - | 1517816..1518502 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| LLE33_RS07925 (LLE33_07925) | - | 1518571..1518732 (-) | 162 | WP_003691530.1 | hypothetical protein | - |
| LLE33_RS07930 (LLE33_07930) | - | 1518729..1519004 (-) | 276 | WP_033911205.1 | NGO1622 family putative holin | - |
| LLE33_RS07935 (LLE33_07935) | - | 1519157..1519489 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| LLE33_RS07940 (LLE33_07940) | - | 1519630..1519825 (-) | 196 | Protein_1545 | hypothetical protein | - |
| LLE33_RS07945 (LLE33_07945) | - | 1520035..1520796 (+) | 762 | WP_012503753.1 | hypothetical protein | - |
| LLE33_RS07950 (LLE33_07950) | - | 1520885..1521229 (-) | 345 | WP_229931773.1 | hypothetical protein | - |
| LLE33_RS07955 (LLE33_07955) | - | 1521310..1521894 (-) | 585 | WP_003693477.1 | Panacea domain-containing protein | - |
| LLE33_RS07960 (LLE33_07960) | - | 1522076..1522477 (-) | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | - |
| LLE33_RS07965 (LLE33_07965) | - | 1522579..1522761 (-) | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | - |
| LLE33_RS07970 (LLE33_07970) | - | 1522931..1523749 (-) | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| LLE33_RS07975 (LLE33_07975) | - | 1524024..1524779 (-) | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| LLE33_RS07980 (LLE33_07980) | - | 1524916..1525101 (+) | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| LLE33_RS07985 (LLE33_07985) | - | 1525190..1525345 (+) | 156 | WP_003698902.1 | hypothetical protein | - |
| LLE33_RS07990 (LLE33_07990) | - | 1525322..1525510 (-) | 189 | WP_003691445.1 | hypothetical protein | - |
| LLE33_RS07995 (LLE33_07995) | - | 1525683..1525910 (+) | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| LLE33_RS11970 | - | 1525907..1526951 (+) | 1045 | Protein_1557 | helix-turn-helix domain-containing protein | - |
| LLE33_RS08010 (LLE33_08010) | - | 1526966..1527745 (+) | 780 | WP_025455898.1 | ATP-binding protein | - |
| LLE33_RS08015 (LLE33_08015) | - | 1527738..1527968 (+) | 231 | WP_012503908.1 | hypothetical protein | - |
| LLE33_RS08020 (LLE33_08020) | - | 1528059..1528553 (+) | 495 | WP_003693463.1 | DUF3310 domain-containing protein | - |
| LLE33_RS08025 (LLE33_08025) | - | 1528748..1528897 (+) | 150 | WP_033911194.1 | phage associated protein | - |
| LLE33_RS08030 (LLE33_08030) | - | 1528925..1529206 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| LLE33_RS08035 (LLE33_08035) | - | 1529197..1529577 (+) | 381 | WP_033911195.1 | RusA family crossover junction endodeoxyribonuclease | - |
| LLE33_RS08040 (LLE33_08040) | - | 1529594..1529722 (-) | 129 | WP_017147221.1 | hypothetical protein | - |
| LLE33_RS08045 (LLE33_08045) | - | 1529906..1530868 (-) | 963 | WP_050160654.1 | IS110 family transposase | - |
| LLE33_RS08050 (LLE33_08050) | - | 1531380..1531739 (-) | 360 | WP_003689732.1 | hypothetical protein | - |
| LLE33_RS08055 (LLE33_08055) | - | 1531860..1532945 (-) | 1086 | WP_003700139.1 | zonular occludens toxin domain-containing protein | - |
| LLE33_RS08060 (LLE33_08060) | - | 1532955..1533245 (-) | 291 | WP_003700141.1 | DUF2523 domain-containing protein | - |
| LLE33_RS08065 (LLE33_08065) | - | 1533246..1534811 (-) | 1566 | WP_167550560.1 | IgG-binding virulence factor TspB family protein | - |
| LLE33_RS08070 (LLE33_08070) | - | 1534753..1535070 (-) | 318 | WP_003689167.1 | DUF1132 family protein | - |
| LLE33_RS08075 (LLE33_08075) | - | 1535198..1535476 (-) | 279 | WP_003689168.1 | hypothetical protein | - |
| LLE33_RS08080 (LLE33_08080) | - | 1535483..1535701 (-) | 219 | WP_003691584.1 | major capsid protein | - |
| LLE33_RS08085 (LLE33_08085) | - | 1535775..1535972 (-) | 198 | WP_003689600.1 | hypothetical protein | - |
| LLE33_RS08090 (LLE33_08090) | - | 1535977..1536267 (-) | 291 | WP_002216601.1 | hypothetical protein | - |
| LLE33_RS08095 (LLE33_08095) | - | 1536312..1537659 (-) | 1348 | Protein_1575 | replication initiation factor domain-containing protein | - |
| LLE33_RS08100 (LLE33_08100) | - | 1537798..1538220 (-) | 423 | WP_003691751.1 | very short patch repair endonuclease | - |
| LLE33_RS08105 (LLE33_08105) | - | 1538226..1538822 (-) | 597 | WP_012503916.1 | TIGR02391 family protein | - |
| LLE33_RS08110 (LLE33_08110) | - | 1539012..1539869 (-) | 858 | WP_012503917.1 | ATP-binding protein | - |
| LLE33_RS08115 (LLE33_08115) | - | 1539883..1540212 (-) | 330 | WP_002234365.1 | DNA cytosine methyltransferase | - |
| LLE33_RS08120 (LLE33_08120) | - | 1540251..1540859 (-) | 609 | WP_080229275.1 | DNA cytosine methyltransferase | - |
| LLE33_RS08125 (LLE33_08125) | - | 1541228..1541374 (+) | 147 | WP_003691757.1 | hypothetical protein | - |
| LLE33_RS08130 (LLE33_08130) | comP | 1541751..1542200 (-) | 450 | WP_002214937.1 | type IV pilin protein | Machinery gene |
Sequence
Protein
Download Length: 149 a.a. Molecular weight: 16834.81 Da Isoelectric Point: 9.7951
>NTDB_id=734693 LLE33_RS08130 WP_002214937.1 1541751..1542200(-) (comP) [Neisseria gonorrhoeae strain 10610]
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
MTDNRGFTLVELISVVLILSVLALIVYPSYRNYVEKAKINAVRAALLENAHFMEKFYLQNGRFKQTSTKWPSLPIKEAEG
FCIRLNGIARGALDSKFMLKAVAIDKDKNPFIIKMNENLVTFICKKSASSCSDGLDYFKGNDKDCKLLK
Nucleotide
Download Length: 450 bp
>NTDB_id=734693 LLE33_RS08130 WP_002214937.1 1541751..1542200(-) (comP) [Neisseria gonorrhoeae strain 10610]
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
ATGACTGATAATCGGGGGTTTACGCTGGTTGAATTAATATCAGTGGTCTTGATATTGTCTGTACTTGCTTTAATTGTTTA
TCCGAGCTATCGCAATTATGTTGAGAAAGCAAAGATAAATGCAGTGCGGGCAGCCTTGTTAGAAAATGCACATTTTATGG
AAAAGTTTTATCTGCAGAATGGGAGATTTAAACAAACATCTACCAAATGGCCAAGTTTGCCGATTAAAGAGGCAGAAGGC
TTTTGTATCCGTTTGAATGGAATCGCGCGCGGGGCTTTAGACAGTAAATTCATGTTGAAGGCGGTAGCCATAGATAAAGA
TAAAAATCCTTTTATTATTAAGATGAATGAAAATCTAGTAACCTTTATTTGCAAGAAGTCCGCCAGTTCGTGTAGTGACG
GGCTGGATTATTTTAAAGGAAATGATAAGGACTGCAAGTTACTTAAGTAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| comP | Neisseria gonorrhoeae MS11 |
100 |
100 |
1 |
| comP | Neisseria meningitidis 8013 |
99.329 |
100 |
0.993 |
| comP | Neisseria subflava NJ9703 |
49.66 |
98.658 |
0.49 |