Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   FNP71_RS13490 Genome accession   NZ_AP019714
Coordinates   2551811..2552194 (-) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. subtilis strain NBRC 13719     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2546811..2557194
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNP71_RS13445 (NBRC13719_25370) sinI 2547669..2547842 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FNP71_RS13455 (NBRC13719_25380) sinR 2547952..2548287 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FNP71_RS13460 (NBRC13719_25390) tasA 2548380..2549165 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  FNP71_RS13465 (NBRC13719_25400) sipW 2549229..2549801 (-) 573 WP_003246088.1 signal peptidase I SipW -
  FNP71_RS13470 (NBRC13719_25410) tapA 2549785..2550546 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  FNP71_RS13475 (NBRC13719_25420) yqzG 2550818..2551144 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  FNP71_RS13480 (NBRC13719_25430) spoIITA 2551186..2551365 (-) 180 WP_003230176.1 YqzE family protein -
  FNP71_RS13485 (NBRC13719_25440) comGG 2551436..2551810 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  FNP71_RS13490 (NBRC13719_25450) comGF 2551811..2552194 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  FNP71_RS13495 (NBRC13719_25460) comGE 2552220..2552567 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  FNP71_RS13500 (NBRC13719_25470) comGD 2552551..2552982 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  FNP71_RS13505 (NBRC13719_25480) comGC 2552972..2553268 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  FNP71_RS13510 (NBRC13719_25490) comGB 2553282..2554319 (-) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  FNP71_RS13515 (NBRC13719_25500) comGA 2554306..2555376 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  FNP71_RS13525 (NBRC13719_25510) corA 2555788..2556741 (-) 954 WP_004399136.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=73435 FNP71_RS13490 WP_003230168.1 2551811..2552194(-) (comGF) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=73435 FNP71_RS13490 WP_003230168.1 2551811..2552194(-) (comGF) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment