Detailed information
Bioinformatically predicted
Overview
| Name | sinI | Type | Regulator |
| Locus tag | FNP71_RS13445 | Genome accession | NZ_AP019714 |
| Coordinates | 2547669..2547842 (+) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0A063X7W9 |
| Organism | Bacillus subtilis subsp. subtilis strain NBRC 13719 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2542669..2552842
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FNP71_RS13430 (NBRC13719_25340) | gcvT | 2543468..2544556 (-) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
| FNP71_RS13435 (NBRC13719_25350) | hepAA | 2544998..2546671 (+) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| FNP71_RS13440 (NBRC13719_25360) | yqhG | 2546692..2547486 (+) | 795 | WP_003230200.1 | YqhG family protein | - |
| FNP71_RS13445 (NBRC13719_25370) | sinI | 2547669..2547842 (+) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| FNP71_RS13455 (NBRC13719_25380) | sinR | 2547952..2548287 (+) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| FNP71_RS13460 (NBRC13719_25390) | tasA | 2548380..2549165 (-) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| FNP71_RS13465 (NBRC13719_25400) | sipW | 2549229..2549801 (-) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| FNP71_RS13470 (NBRC13719_25410) | tapA | 2549785..2550546 (-) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| FNP71_RS13475 (NBRC13719_25420) | yqzG | 2550818..2551144 (+) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| FNP71_RS13480 (NBRC13719_25430) | spoIITA | 2551186..2551365 (-) | 180 | WP_003230176.1 | YqzE family protein | - |
| FNP71_RS13485 (NBRC13719_25440) | comGG | 2551436..2551810 (-) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| FNP71_RS13490 (NBRC13719_25450) | comGF | 2551811..2552194 (-) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| FNP71_RS13495 (NBRC13719_25460) | comGE | 2552220..2552567 (-) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=73432 FNP71_RS13445 WP_003230187.1 2547669..2547842(+) (sinI) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=73432 FNP71_RS13445 WP_003230187.1 2547669..2547842(+) (sinI) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |