Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   FNP71_RS13445 Genome accession   NZ_AP019714
Coordinates   2547669..2547842 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. subtilis strain NBRC 13719     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2542669..2552842
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  FNP71_RS13430 (NBRC13719_25340) gcvT 2543468..2544556 (-) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -
  FNP71_RS13435 (NBRC13719_25350) hepAA 2544998..2546671 (+) 1674 WP_004398544.1 SNF2-related protein -
  FNP71_RS13440 (NBRC13719_25360) yqhG 2546692..2547486 (+) 795 WP_003230200.1 YqhG family protein -
  FNP71_RS13445 (NBRC13719_25370) sinI 2547669..2547842 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  FNP71_RS13455 (NBRC13719_25380) sinR 2547952..2548287 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  FNP71_RS13460 (NBRC13719_25390) tasA 2548380..2549165 (-) 786 WP_004398632.1 biofilm matrix protein TasA -
  FNP71_RS13465 (NBRC13719_25400) sipW 2549229..2549801 (-) 573 WP_003246088.1 signal peptidase I SipW -
  FNP71_RS13470 (NBRC13719_25410) tapA 2549785..2550546 (-) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  FNP71_RS13475 (NBRC13719_25420) yqzG 2550818..2551144 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  FNP71_RS13480 (NBRC13719_25430) spoIITA 2551186..2551365 (-) 180 WP_003230176.1 YqzE family protein -
  FNP71_RS13485 (NBRC13719_25440) comGG 2551436..2551810 (-) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  FNP71_RS13490 (NBRC13719_25450) comGF 2551811..2552194 (-) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  FNP71_RS13495 (NBRC13719_25460) comGE 2552220..2552567 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=73432 FNP71_RS13445 WP_003230187.1 2547669..2547842(+) (sinI) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=73432 FNP71_RS13445 WP_003230187.1 2547669..2547842(+) (sinI) [Bacillus subtilis subsp. subtilis strain NBRC 13719]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1


Multiple sequence alignment