Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   P5649_RS13610 Genome accession   NZ_CP120613
Coordinates   2603686..2603859 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0ABU0V3E4
Organism   Bacillus subtilis strain DSM 23521     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2598686..2608859
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5649_RS13565 (P5649_13565) comGE 2599038..2599385 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5649_RS13570 (P5649_13570) comGF 2599411..2599794 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5649_RS13575 (P5649_13575) comGG 2599795..2600169 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5649_RS13580 (P5649_13580) spoIITA 2600240..2600419 (+) 180 WP_003230176.1 YqzE family protein -
  P5649_RS13585 (P5649_13585) yqzG 2600461..2600787 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5649_RS13590 (P5649_13590) tapA 2601059..2601820 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5649_RS13595 (P5649_13595) sipW 2601804..2602376 (+) 573 WP_003246088.1 signal peptidase I SipW -
  P5649_RS13600 (P5649_13600) tasA 2602440..2603225 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5649_RS13605 (P5649_13605) sinR 2603317..2603652 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5649_RS13610 (P5649_13610) sinI 2603686..2603859 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  P5649_RS13615 (P5649_13615) yqhG 2604042..2604836 (-) 795 WP_003230200.1 YqhG family protein -
  P5649_RS13620 (P5649_13620) hepAA 2604857..2606530 (-) 1674 WP_004398544.1 SNF2-related protein -
  P5649_RS13625 (P5649_13625) gcvT 2606972..2608060 (+) 1089 WP_004398598.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=733154 P5649_RS13610 WP_003230187.1 2603686..2603859(-) (sinI) [Bacillus subtilis strain DSM 23521]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=733154 P5649_RS13610 WP_003230187.1 2603686..2603859(-) (sinI) [Bacillus subtilis strain DSM 23521]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterProScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1