Detailed information
Overview
| Name | sinI | Type | Regulator |
| Locus tag | P5649_RS13610 | Genome accession | NZ_CP120613 |
| Coordinates | 2603686..2603859 (-) | Length | 57 a.a. |
| NCBI ID | WP_003230187.1 | Uniprot ID | A0ABU0V3E4 |
| Organism | Bacillus subtilis strain DSM 23521 | ||
| Function | inhibit the expression of sinR (predicted from homology) Competence regulation |
||
Genomic Context
Location: 2598686..2608859
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| P5649_RS13565 (P5649_13565) | comGE | 2599038..2599385 (+) | 348 | WP_003230165.1 | ComG operon protein 5 | Machinery gene |
| P5649_RS13570 (P5649_13570) | comGF | 2599411..2599794 (+) | 384 | WP_003230168.1 | ComG operon protein ComGF | Machinery gene |
| P5649_RS13575 (P5649_13575) | comGG | 2599795..2600169 (+) | 375 | WP_003230170.1 | ComG operon protein ComGG | Machinery gene |
| P5649_RS13580 (P5649_13580) | spoIITA | 2600240..2600419 (+) | 180 | WP_003230176.1 | YqzE family protein | - |
| P5649_RS13585 (P5649_13585) | yqzG | 2600461..2600787 (-) | 327 | WP_003246051.1 | YqzG/YhdC family protein | - |
| P5649_RS13590 (P5649_13590) | tapA | 2601059..2601820 (+) | 762 | WP_004399106.1 | amyloid fiber anchoring/assembly protein TapA | - |
| P5649_RS13595 (P5649_13595) | sipW | 2601804..2602376 (+) | 573 | WP_003246088.1 | signal peptidase I SipW | - |
| P5649_RS13600 (P5649_13600) | tasA | 2602440..2603225 (+) | 786 | WP_004398632.1 | biofilm matrix protein TasA | - |
| P5649_RS13605 (P5649_13605) | sinR | 2603317..2603652 (-) | 336 | WP_003226345.1 | transcriptional regulator SinR | Regulator |
| P5649_RS13610 (P5649_13610) | sinI | 2603686..2603859 (-) | 174 | WP_003230187.1 | anti-repressor SinI | Regulator |
| P5649_RS13615 (P5649_13615) | yqhG | 2604042..2604836 (-) | 795 | WP_003230200.1 | YqhG family protein | - |
| P5649_RS13620 (P5649_13620) | hepAA | 2604857..2606530 (-) | 1674 | WP_004398544.1 | SNF2-related protein | - |
| P5649_RS13625 (P5649_13625) | gcvT | 2606972..2608060 (+) | 1089 | WP_004398598.1 | glycine cleavage system aminomethyltransferase GcvT | - |
Sequence
Protein
Download Length: 57 a.a. Molecular weight: 6601.52 Da Isoelectric Point: 6.7231
>NTDB_id=733154 P5649_RS13610 WP_003230187.1 2603686..2603859(-) (sinI) [Bacillus subtilis strain DSM 23521]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF
Nucleotide
Download Length: 174 bp
>NTDB_id=733154 P5649_RS13610 WP_003230187.1 2603686..2603859(-) (sinI) [Bacillus subtilis strain DSM 23521]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| sinI | Bacillus subtilis subsp. subtilis str. 168 |
100 |
100 |
1 |