Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   P5649_RS13570 Genome accession   NZ_CP120613
Coordinates   2599411..2599794 (+) Length   127 a.a.
NCBI ID   WP_003230168.1    Uniprot ID   P25958
Organism   Bacillus subtilis strain DSM 23521     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2594411..2604794
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  P5649_RS13540 (P5649_13540) corA 2594864..2595817 (+) 954 WP_004399136.1 magnesium transporter CorA -
  P5649_RS13545 (P5649_13545) comGA 2596229..2597299 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  P5649_RS13550 (P5649_13550) comGB 2597286..2598323 (+) 1038 WP_009967727.1 comG operon protein ComGB Machinery gene
  P5649_RS13555 (P5649_13555) comGC 2598337..2598633 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  P5649_RS13560 (P5649_13560) comGD 2598623..2599054 (+) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  P5649_RS13565 (P5649_13565) comGE 2599038..2599385 (+) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  P5649_RS13570 (P5649_13570) comGF 2599411..2599794 (+) 384 WP_003230168.1 ComG operon protein ComGF Machinery gene
  P5649_RS13575 (P5649_13575) comGG 2599795..2600169 (+) 375 WP_003230170.1 ComG operon protein ComGG Machinery gene
  P5649_RS13580 (P5649_13580) spoIITA 2600240..2600419 (+) 180 WP_003230176.1 YqzE family protein -
  P5649_RS13585 (P5649_13585) yqzG 2600461..2600787 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  P5649_RS13590 (P5649_13590) tapA 2601059..2601820 (+) 762 WP_004399106.1 amyloid fiber anchoring/assembly protein TapA -
  P5649_RS13595 (P5649_13595) sipW 2601804..2602376 (+) 573 WP_003246088.1 signal peptidase I SipW -
  P5649_RS13600 (P5649_13600) tasA 2602440..2603225 (+) 786 WP_004398632.1 biofilm matrix protein TasA -
  P5649_RS13605 (P5649_13605) sinR 2603317..2603652 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  P5649_RS13610 (P5649_13610) sinI 2603686..2603859 (-) 174 WP_003230187.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14281.37 Da        Isoelectric Point: 5.8929

>NTDB_id=733151 P5649_RS13570 WP_003230168.1 2599411..2599794(+) (comGF) [Bacillus subtilis strain DSM 23521]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=733151 P5649_RS13570 WP_003230168.1 2599411..2599794(+) (comGF) [Bacillus subtilis strain DSM 23521]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
GGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAAGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB P25958

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

100

100

1