Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N8A75_RS17160 Genome accession   NZ_CP104878
Coordinates   3140756..3140896 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain 4ZT     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3135756..3145896
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N8A75_RS17135 (N8A75_17135) yuxO 3136106..3136486 (-) 381 WP_014477831.1 hotdog fold thioesterase -
  N8A75_RS17140 (N8A75_17140) comA 3136505..3137149 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  N8A75_RS17145 (N8A75_17145) comP 3137230..3139527 (-) 2298 WP_087614687.1 histidine kinase Regulator
  N8A75_RS17150 (N8A75_17150) comX 3139535..3139696 (-) 162 WP_003241045.1 competence pheromone ComX -
  N8A75_RS17155 (N8A75_17155) - 3139711..3140571 (-) 861 WP_046160795.1 polyprenyl synthetase family protein -
  N8A75_RS17160 (N8A75_17160) degQ 3140756..3140896 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N8A75_RS17165 (N8A75_17165) - 3141118..3141243 (+) 126 WP_120028613.1 hypothetical protein -
  N8A75_RS17170 (N8A75_17170) - 3141358..3141726 (+) 369 WP_017695529.1 hypothetical protein -
  N8A75_RS17175 (N8A75_17175) pdeH 3141702..3142931 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  N8A75_RS17180 (N8A75_17180) pncB 3143068..3144540 (-) 1473 WP_129110551.1 nicotinate phosphoribosyltransferase -
  N8A75_RS17185 (N8A75_17185) pncA 3144556..3145107 (-) 552 WP_262091009.1 cysteine hydrolase family protein -
  N8A75_RS17190 (N8A75_17190) yueI 3145204..3145602 (-) 399 WP_015251331.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=733146 N8A75_RS17160 WP_003220708.1 3140756..3140896(-) (degQ) [Bacillus subtilis strain 4ZT]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=733146 N8A75_RS17160 WP_003220708.1 3140756..3140896(-) (degQ) [Bacillus subtilis strain 4ZT]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1