Detailed information    

insolico Bioinformatically predicted

Overview


Name   sinI   Type   Regulator
Locus tag   N1207_RS13475 Genome accession   NZ_CP104097
Coordinates   2580250..2580423 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain GL-4     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context


Location: 2575250..2585423
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N1207_RS13460 (N1207_13460) gcvT 2576050..2577138 (-) 1089 WP_041850013.1 glycine cleavage system aminomethyltransferase GcvT -
  N1207_RS13465 (N1207_13465) hepAA 2577579..2579252 (+) 1674 WP_041850014.1 DEAD/DEAH box helicase -
  N1207_RS13470 (N1207_13470) yqhG 2579273..2580067 (+) 795 WP_003230200.1 YqhG family protein -
  N1207_RS13475 (N1207_13475) sinI 2580250..2580423 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N1207_RS13480 (N1207_13480) sinR 2580457..2580792 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N1207_RS13485 (N1207_13485) tasA 2580885..2581670 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  N1207_RS13490 (N1207_13490) sipW 2581734..2582306 (-) 573 WP_003246088.1 signal peptidase I SipW -
  N1207_RS13495 (N1207_13495) tapA 2582290..2583051 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N1207_RS13500 (N1207_13500) yqzG 2583323..2583649 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N1207_RS13505 (N1207_13505) spoIITA 2583691..2583870 (-) 180 WP_003230176.1 YqzE family protein -
  N1207_RS13510 (N1207_13510) comGG 2583941..2584315 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N1207_RS13515 (N1207_13515) comGF 2584316..2584699 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N1207_RS13520 (N1207_13520) comGE 2584725..2585072 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene

Sequence


Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=727563 N1207_RS13475 WP_003230187.1 2580250..2580423(+) (sinI) [Bacillus subtilis strain GL-4]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=727563 N1207_RS13475 WP_003230187.1 2580250..2580423(+) (sinI) [Bacillus subtilis strain GL-4]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains


Predicted by InterproScan.

(11-36)


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1