Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   N1207_RS13515 Genome accession   NZ_CP104097
Coordinates   2584316..2584699 (-) Length   127 a.a.
NCBI ID   WP_041850015.1    Uniprot ID   -
Organism   Bacillus subtilis strain GL-4     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2579316..2589699
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N1207_RS13475 (N1207_13475) sinI 2580250..2580423 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  N1207_RS13480 (N1207_13480) sinR 2580457..2580792 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  N1207_RS13485 (N1207_13485) tasA 2580885..2581670 (-) 786 WP_015251717.1 biofilm matrix protein TasA -
  N1207_RS13490 (N1207_13490) sipW 2581734..2582306 (-) 573 WP_003246088.1 signal peptidase I SipW -
  N1207_RS13495 (N1207_13495) tapA 2582290..2583051 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  N1207_RS13500 (N1207_13500) yqzG 2583323..2583649 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  N1207_RS13505 (N1207_13505) spoIITA 2583691..2583870 (-) 180 WP_003230176.1 YqzE family protein -
  N1207_RS13510 (N1207_13510) comGG 2583941..2584315 (-) 375 WP_015251714.1 ComG operon protein ComGG Machinery gene
  N1207_RS13515 (N1207_13515) comGF 2584316..2584699 (-) 384 WP_041850015.1 ComG operon protein ComGF Machinery gene
  N1207_RS13520 (N1207_13520) comGE 2584725..2585072 (-) 348 WP_003230165.1 ComG operon protein 5 Machinery gene
  N1207_RS13525 (N1207_13525) comGD 2585056..2585487 (-) 432 WP_004398628.1 comG operon protein ComGD Machinery gene
  N1207_RS13530 (N1207_13530) comGC 2585477..2585773 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  N1207_RS13535 (N1207_13535) comGB 2585787..2586824 (-) 1038 WP_041850016.1 comG operon protein ComGB Machinery gene
  N1207_RS13540 (N1207_13540) comGA 2586811..2587881 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  N1207_RS13545 (N1207_13545) corA 2588292..2589245 (-) 954 WP_029317911.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14250.41 Da        Isoelectric Point: 6.4838

>NTDB_id=727566 N1207_RS13515 WP_041850015.1 2584316..2584699(-) (comGF) [Bacillus subtilis strain GL-4]
MLISGSLAAIIHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHIAAMKADIKNGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=727566 N1207_RS13515 WP_041850015.1 2584316..2584699(-) (comGF) [Bacillus subtilis strain GL-4]
TTGCTCATATCAGGATCGTTAGCTGCGATTATCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCTATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTGCTGCCATGAAAGCTGATATTAAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACAGCTTTTCCGGTCTATTCGTATTTAGGAGGAGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984