Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   N0B18_RS16455 Genome accession   NZ_CP103995
Coordinates   3053930..3054070 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM117109     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3048930..3059070
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  N0B18_RS16430 (N0B18_16430) yuxO 3049207..3049587 (-) 381 WP_069837723.1 hotdog fold thioesterase -
  N0B18_RS16435 (N0B18_16435) comA 3049606..3050250 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  N0B18_RS16440 (N0B18_16440) comP 3050331..3052643 (-) 2313 WP_069964288.1 sensor histidine kinase Regulator
  N0B18_RS16445 (N0B18_16445) comX 3052659..3052880 (-) 222 WP_014480704.1 competence pheromone ComX -
  N0B18_RS16450 (N0B18_16450) - 3052882..3053745 (-) 864 WP_014480705.1 polyprenyl synthetase family protein -
  N0B18_RS16455 (N0B18_16455) degQ 3053930..3054070 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  N0B18_RS16460 (N0B18_16460) - 3054292..3054417 (+) 126 WP_003228793.1 hypothetical protein -
  N0B18_RS16465 (N0B18_16465) - 3054532..3054900 (+) 369 WP_046381300.1 hypothetical protein -
  N0B18_RS16470 (N0B18_16470) pdeH 3054876..3056105 (-) 1230 WP_046381301.1 cyclic di-GMP phosphodiesterase -
  N0B18_RS16475 (N0B18_16475) pncB 3056241..3057713 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  N0B18_RS16480 (N0B18_16480) pncA 3057729..3058280 (-) 552 WP_014480709.1 cysteine hydrolase family protein -
  N0B18_RS16485 (N0B18_16485) yueI 3058377..3058775 (-) 399 WP_014480710.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=726863 N0B18_RS16455 WP_003220708.1 3053930..3054070(-) (degQ) [Bacillus subtilis strain SRCM117109]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=726863 N0B18_RS16455 WP_003220708.1 3053930..3054070(-) (degQ) [Bacillus subtilis strain SRCM117109]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1