Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGD   Type   Machinery gene
Locus tag   NYR93_RS03435 Genome accession   NZ_CP103769
Coordinates   652320..652757 (+) Length   145 a.a.
NCBI ID   WP_043867285.1    Uniprot ID   -
Organism   Bacillus velezensis strain ML61     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 647320..657757
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR93_RS03410 (NYR93_03410) - 647334..648635 (-) 1302 WP_264254869.1 hemolysin family protein -
  NYR93_RS03415 (NYR93_03415) - 648781..649731 (+) 951 WP_003153082.1 magnesium transporter CorA family protein -
  NYR93_RS03420 (NYR93_03420) comGA 649923..650993 (+) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NYR93_RS03425 (NYR93_03425) comGB 650980..652017 (+) 1038 WP_014305414.1 competence type IV pilus assembly protein ComGB Machinery gene
  NYR93_RS03430 (NYR93_03430) comGC 652022..652330 (+) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NYR93_RS03435 (NYR93_03435) comGD 652320..652757 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  NYR93_RS03440 (NYR93_03440) comGE 652741..653055 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NYR93_RS03445 (NYR93_03445) comGF 653069..653464 (+) 396 WP_264254870.1 competence type IV pilus minor pilin ComGF -
  NYR93_RS03450 (NYR93_03450) comGG 653465..653842 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYR93_RS03455 (NYR93_03455) - 653899..654078 (+) 180 WP_003153093.1 YqzE family protein -
  NYR93_RS03460 (NYR93_03460) - 654118..654447 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NYR93_RS03465 (NYR93_03465) tapA 654706..655377 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NYR93_RS03470 (NYR93_03470) sipW 655349..655933 (+) 585 WP_012117977.1 signal peptidase I SipW -
  NYR93_RS03475 (NYR93_03475) tasA 655997..656782 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  NYR93_RS03480 (NYR93_03480) sinR 656830..657165 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYR93_RS03485 (NYR93_03485) sinI 657199..657372 (-) 174 WP_003153105.1 anti-repressor SinI Regulator

Sequence


Protein


Download         Length: 145 a.a.        Molecular weight: 16268.79 Da        Isoelectric Point: 10.3354

>NTDB_id=724611 NYR93_RS03435 WP_043867285.1 652320..652757(+) (comGD) [Bacillus velezensis strain ML61]
MNNNRRTENGFTLLESLVVLSLASVLLTVLFTTVPPVCTHLAVRQKTEQLQKDIQLAQETAIAEHKRTKITFLPKEHKYK
LQSGGRIVERSFDSLHITLVTLPESLEFNEKGHPNSGGKIRLKSAGFTYEITVYLGSGNVHAKRK

Nucleotide


Download         Length: 438 bp        

>NTDB_id=724611 NYR93_RS03435 WP_043867285.1 652320..652757(+) (comGD) [Bacillus velezensis strain ML61]
TTGAACAATAACAGGCGGACAGAAAACGGGTTTACCCTTCTTGAAAGCCTGGTTGTGTTAAGCCTGGCGTCCGTCCTGCT
GACGGTTTTGTTCACGACGGTTCCGCCGGTCTGCACCCACCTTGCCGTGCGGCAAAAAACAGAACAGCTTCAAAAAGATA
TTCAGCTTGCGCAGGAAACGGCTATCGCAGAACATAAAAGAACAAAAATCACTTTTCTTCCAAAAGAGCATAAATACAAA
CTGCAGTCAGGCGGTAGGATTGTTGAGCGTTCTTTTGATTCGCTTCACATTACACTTGTGACTTTACCGGAGAGCCTTGA
ATTTAACGAAAAAGGCCATCCGAATTCGGGAGGAAAGATTCGATTGAAGAGCGCCGGGTTCACCTATGAGATCACAGTTT
ACTTAGGGAGCGGAAATGTCCATGCTAAACGGAAATAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGD Bacillus subtilis subsp. subtilis str. 168

56.164

100

0.566