Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NYR93_RS03485 Genome accession   NZ_CP103769
Coordinates   657199..657372 (-) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain ML61     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 652199..662372
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NYR93_RS03435 (NYR93_03435) comGD 652320..652757 (+) 438 WP_043867285.1 competence type IV pilus minor pilin ComGD Machinery gene
  NYR93_RS03440 (NYR93_03440) comGE 652741..653055 (+) 315 WP_015388003.1 competence type IV pilus minor pilin ComGE Machinery gene
  NYR93_RS03445 (NYR93_03445) comGF 653069..653464 (+) 396 WP_264254870.1 competence type IV pilus minor pilin ComGF -
  NYR93_RS03450 (NYR93_03450) comGG 653465..653842 (+) 378 WP_014305410.1 competence type IV pilus minor pilin ComGG Machinery gene
  NYR93_RS03455 (NYR93_03455) - 653899..654078 (+) 180 WP_003153093.1 YqzE family protein -
  NYR93_RS03460 (NYR93_03460) - 654118..654447 (-) 330 WP_003153097.1 DUF3889 domain-containing protein -
  NYR93_RS03465 (NYR93_03465) tapA 654706..655377 (+) 672 WP_003153099.1 amyloid fiber anchoring/assembly protein TapA -
  NYR93_RS03470 (NYR93_03470) sipW 655349..655933 (+) 585 WP_012117977.1 signal peptidase I SipW -
  NYR93_RS03475 (NYR93_03475) tasA 655997..656782 (+) 786 WP_003153102.1 biofilm matrix protein TasA -
  NYR93_RS03480 (NYR93_03480) sinR 656830..657165 (-) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NYR93_RS03485 (NYR93_03485) sinI 657199..657372 (-) 174 WP_003153105.1 anti-repressor SinI Regulator
  NYR93_RS03490 (NYR93_03490) - 657549..658343 (-) 795 WP_264254871.1 YqhG family protein -
  NYR93_RS03495 (NYR93_03495) - 658361..660031 (-) 1671 WP_003153107.1 DEAD/DEAH box helicase -
  NYR93_RS03500 (NYR93_03500) gcvT 660454..661554 (+) 1101 WP_014305405.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=724615 NYR93_RS03485 WP_003153105.1 657199..657372(-) (sinI) [Bacillus velezensis strain ML61]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=724615 NYR93_RS03485 WP_003153105.1 657199..657372(-) (sinI) [Bacillus velezensis strain ML61]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702