Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NX050_RS09260 Genome accession   NZ_CP103456
Coordinates   1746670..1747044 (+) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain PN176 (HK176)     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 1741670..1752044
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX050_RS09220 (NX050_09220) corA 1741740..1742693 (+) 954 WP_014480260.1 magnesium transporter CorA -
  NX050_RS09225 (NX050_09225) - 1742695..1742892 (+) 198 WP_014480259.1 CBS domain-containing protein -
  NX050_RS09230 (NX050_09230) comGA 1743104..1744174 (+) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NX050_RS09235 (NX050_09235) comGB 1744161..1745198 (+) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  NX050_RS09240 (NX050_09240) comGC 1745212..1745508 (+) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NX050_RS09245 (NX050_09245) comGD 1745498..1745929 (+) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  NX050_RS09250 (NX050_09250) comGE 1745913..1746260 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NX050_RS09255 (NX050_09255) comGF 1746286..1746669 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NX050_RS09260 (NX050_09260) comGG 1746670..1747044 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NX050_RS09265 (NX050_09265) spoIITA 1747115..1747294 (+) 180 WP_014480252.1 YqzE family protein -
  NX050_RS09270 (NX050_09270) yqzG 1747336..1747662 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX050_RS09275 (NX050_09275) tapA 1747934..1748695 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NX050_RS09280 (NX050_09280) sipW 1748679..1749251 (+) 573 WP_003230181.1 signal peptidase I SipW -
  NX050_RS09285 (NX050_09285) tasA 1749315..1750100 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  NX050_RS09290 (NX050_09290) sinR 1750193..1750528 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX050_RS09295 (NX050_09295) sinI 1750562..1750735 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX050_RS09300 (NX050_09300) yqhG 1750918..1751712 (-) 795 WP_014480249.1 YqhG family protein -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=722881 NX050_RS09260 WP_014480253.1 1746670..1747044(+) (comGG) [Bacillus subtilis strain PN176 (HK176)]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=722881 NX050_RS09260 WP_014480253.1 1746670..1747044(+) (comGG) [Bacillus subtilis strain PN176 (HK176)]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976