Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX050_RS09295 Genome accession   NZ_CP103456
Coordinates   1750562..1750735 (-) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain PN176 (HK176)     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 1745562..1755735
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX050_RS09250 (NX050_09250) comGE 1745913..1746260 (+) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NX050_RS09255 (NX050_09255) comGF 1746286..1746669 (+) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NX050_RS09260 (NX050_09260) comGG 1746670..1747044 (+) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NX050_RS09265 (NX050_09265) spoIITA 1747115..1747294 (+) 180 WP_014480252.1 YqzE family protein -
  NX050_RS09270 (NX050_09270) yqzG 1747336..1747662 (-) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX050_RS09275 (NX050_09275) tapA 1747934..1748695 (+) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NX050_RS09280 (NX050_09280) sipW 1748679..1749251 (+) 573 WP_003230181.1 signal peptidase I SipW -
  NX050_RS09285 (NX050_09285) tasA 1749315..1750100 (+) 786 WP_014480250.1 biofilm matrix protein TasA -
  NX050_RS09290 (NX050_09290) sinR 1750193..1750528 (-) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX050_RS09295 (NX050_09295) sinI 1750562..1750735 (-) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX050_RS09300 (NX050_09300) yqhG 1750918..1751712 (-) 795 WP_014480249.1 YqhG family protein -
  NX050_RS09305 (NX050_09305) hepAA 1751733..1753406 (-) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  NX050_RS09310 (NX050_09310) gcvT 1753848..1754936 (+) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=722883 NX050_RS09295 WP_003230187.1 1750562..1750735(-) (sinI) [Bacillus subtilis strain PN176 (HK176)]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=722883 NX050_RS09295 WP_003230187.1 1750562..1750735(-) (sinI) [Bacillus subtilis strain PN176 (HK176)]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1