Detailed information    

insolico Bioinformatically predicted

Overview


Name   ssbA   Type   Machinery gene
Locus tag   NVV71_RS04215 Genome accession   NZ_CP103399
Coordinates   752634..753113 (+) Length   159 a.a.
NCBI ID   WP_112120314.1    Uniprot ID   -
Organism   Listeria innocua strain F6215     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 736689..788371 752634..753113 within 0


Gene organization within MGE regions


Location: 736689..788371
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NVV71_RS04060 (NVV71_04060) - 736689..737036 (+) 348 WP_003749261.1 helix-turn-helix domain-containing protein -
  NVV71_RS04065 (NVV71_04065) - 737084..737551 (-) 468 WP_185547965.1 competence protein ComK -
  NVV71_RS04070 (NVV71_04070) - 737542..738900 (-) 1359 WP_070030387.1 recombinase family protein -
  NVV71_RS04075 (NVV71_04075) - 738964..739704 (-) 741 WP_003727737.1 hypothetical protein -
  NVV71_RS04080 (NVV71_04080) - 739726..740448 (-) 723 WP_003727738.1 hypothetical protein -
  NVV71_RS04085 (NVV71_04085) - 740508..741215 (-) 708 WP_187989104.1 hypothetical protein -
  NVV71_RS04090 (NVV71_04090) - 741277..741882 (-) 606 WP_020830685.1 hypothetical protein -
  NVV71_RS14940 - 741897..742115 (-) 219 WP_003725101.1 zinc-ribbon domain-containing protein -
  NVV71_RS04095 (NVV71_04095) - 742138..742629 (-) 492 WP_003725100.1 ImmA/IrrE family metallo-endopeptidase -
  NVV71_RS04100 (NVV71_04100) - 742660..742965 (-) 306 WP_039381694.1 helix-turn-helix domain-containing protein -
  NVV71_RS04105 (NVV71_04105) - 743141..743344 (+) 204 WP_026747215.1 helix-turn-helix transcriptional regulator -
  NVV71_RS04110 (NVV71_04110) - 743365..743559 (+) 195 WP_003733687.1 hypothetical protein -
  NVV71_RS04115 (NVV71_04115) - 743571..743837 (+) 267 WP_010991179.1 hypothetical protein -
  NVV71_RS04120 (NVV71_04120) - 743837..743998 (+) 162 WP_010991178.1 hypothetical protein -
  NVV71_RS04125 (NVV71_04125) - 743991..744233 (-) 243 WP_023552476.1 hypothetical protein -
  NVV71_RS04130 (NVV71_04130) - 744297..745067 (+) 771 WP_010991177.1 phage repressor protein/antirepressor Ant -
  NVV71_RS04135 (NVV71_04135) - 745190..745723 (+) 534 WP_010991176.1 hypothetical protein -
  NVV71_RS04140 (NVV71_04140) - 745720..745935 (+) 216 WP_003727752.1 hypothetical protein -
  NVV71_RS04145 (NVV71_04145) - 746043..746231 (+) 189 WP_045607603.1 gp45 family putative tail fiber system protein -
  NVV71_RS04150 (NVV71_04150) - 746313..746441 (+) 129 WP_009930468.1 hypothetical protein -
  NVV71_RS04155 (NVV71_04155) - 746537..746731 (+) 195 WP_003734953.1 hypothetical protein -
  NVV71_RS04160 (NVV71_04160) - 746728..747204 (+) 477 WP_187989103.1 siphovirus Gp157 family protein -
  NVV71_RS04165 (NVV71_04165) - 747210..747869 (+) 660 WP_187989102.1 ERF family protein -
  NVV71_RS04170 (NVV71_04170) - 747886..748863 (+) 978 WP_187989101.1 phage replisome organizer N-terminal domain-containing protein -
  NVV71_RS04175 (NVV71_04175) - 748860..749027 (+) 168 WP_015987078.1 hypothetical protein -
  NVV71_RS14945 - 749033..749317 (+) 285 WP_308219097.1 hypothetical protein -
  NVV71_RS04180 (NVV71_04180) - 749314..749757 (+) 444 WP_187989100.1 hypothetical protein -
  NVV71_RS04185 (NVV71_04185) - 749774..750151 (+) 378 WP_259002846.1 hypothetical protein -
  NVV71_RS04190 (NVV71_04190) - 750151..751131 (+) 981 WP_187989098.1 DNA cytosine methyltransferase -
  NVV71_RS04195 (NVV71_04195) - 751128..751499 (+) 372 WP_187989097.1 hypothetical protein -
  NVV71_RS04200 (NVV71_04200) - 751496..751906 (+) 411 WP_187989096.1 YopX family protein -
  NVV71_RS04205 (NVV71_04205) - 751994..752221 (+) 228 WP_020830813.1 ASCH/PUA domain-containing protein -
  NVV71_RS04210 (NVV71_04210) - 752233..752634 (+) 402 WP_071661751.1 hypothetical protein -
  NVV71_RS04215 (NVV71_04215) ssbA 752634..753113 (+) 480 WP_112120314.1 single-stranded DNA-binding protein Machinery gene
  NVV71_RS04220 (NVV71_04220) - 753132..753314 (+) 183 WP_187989095.1 hypothetical protein -
  NVV71_RS04225 (NVV71_04225) - 753259..753663 (+) 405 WP_187989094.1 DUF1064 domain-containing protein -
  NVV71_RS04230 (NVV71_04230) - 753667..754059 (+) 393 WP_187989093.1 DUF2481 family protein -
  NVV71_RS04235 (NVV71_04235) - 754078..754233 (+) 156 WP_003722548.1 hypothetical protein -
  NVV71_RS04240 (NVV71_04240) - 754321..754893 (+) 573 WP_070209727.1 sigma-70 family RNA polymerase sigma factor -
  NVV71_RS04245 (NVV71_04245) - 755427..755729 (+) 303 WP_120136319.1 hypothetical protein -
  NVV71_RS04250 (NVV71_04250) - 755777..756004 (+) 228 WP_003740921.1 hypothetical protein -
  NVV71_RS04255 (NVV71_04255) terS 756044..756784 (+) 741 WP_003740918.1 phage terminase small subunit -
  NVV71_RS04260 (NVV71_04260) - 756750..758096 (+) 1347 WP_070277870.1 PBSX family phage terminase large subunit -
  NVV71_RS04265 (NVV71_04265) - 758111..759670 (+) 1560 WP_187989092.1 hypothetical protein -
  NVV71_RS04270 (NVV71_04270) - 759675..760718 (+) 1044 WP_003725070.1 phage minor capsid protein -
  NVV71_RS04275 (NVV71_04275) - 760813..761367 (+) 555 WP_003740894.1 hypothetical protein -
  NVV71_RS04280 (NVV71_04280) - 761390..762262 (+) 873 WP_003740892.1 hypothetical protein -
  NVV71_RS04285 (NVV71_04285) - 762276..762431 (+) 156 WP_010991157.1 hypothetical protein -
  NVV71_RS04290 (NVV71_04290) - 762432..762785 (+) 354 WP_003740890.1 hypothetical protein -
  NVV71_RS04295 (NVV71_04295) - 762785..763150 (+) 366 WP_010991156.1 hypothetical protein -
  NVV71_RS04300 (NVV71_04300) - 763140..763457 (+) 318 WP_096811313.1 HK97 gp10 family phage protein -
  NVV71_RS04305 (NVV71_04305) - 763454..763825 (+) 372 WP_120021247.1 hypothetical protein -
  NVV71_RS04310 (NVV71_04310) - 763830..764516 (+) 687 WP_187989091.1 phage tail tube protein -
  NVV71_RS04315 (NVV71_04315) - 764566..764997 (+) 432 WP_003753491.1 hypothetical protein -
  NVV71_RS04320 (NVV71_04320) - 765030..765305 (+) 276 WP_031644303.1 Gp15 family bacteriophage protein -
  NVV71_RS14960 - 765310..770109 (+) 4800 Protein_770 phage tail tape measure protein -
  NVV71_RS04335 (NVV71_04335) - 770113..770937 (+) 825 WP_003725059.1 phage tail family protein -
  NVV71_RS04340 (NVV71_04340) - 770950..771963 (+) 1014 WP_003740854.1 phage tail protein -
  NVV71_RS04345 (NVV71_04345) - 771960..772988 (+) 1029 WP_010991151.1 hypothetical protein -
  NVV71_RS04350 (NVV71_04350) - 772985..774052 (+) 1068 WP_021496264.1 BppU family phage baseplate upper protein -
  NVV71_RS04355 (NVV71_04355) - 774049..774390 (+) 342 WP_003725055.1 hypothetical protein -
  NVV71_RS04360 (NVV71_04360) - 774391..774537 (+) 147 WP_012581446.1 XkdX family protein -
  NVV71_RS04365 (NVV71_04365) - 774578..774883 (+) 306 WP_003733957.1 hypothetical protein -
  NVV71_RS04370 (NVV71_04370) - 774883..775164 (+) 282 WP_020830702.1 phage holin -
  NVV71_RS04375 (NVV71_04375) - 775164..776033 (+) 870 WP_187989090.1 N-acetylmuramoyl-L-alanine amidase family protein -
  NVV71_RS04380 (NVV71_04380) - 776396..777292 (+) 897 WP_010991148.1 Abi family protein -
  NVV71_RS04385 (NVV71_04385) - 777367..777573 (-) 207 WP_031645791.1 hypothetical protein -
  NVV71_RS04390 (NVV71_04390) - 778133..778336 (-) 204 Protein_782 competence protein ComK -
  NVV71_RS04395 (NVV71_04395) - 778466..778822 (+) 357 WP_077904838.1 IDEAL domain-containing protein -
  NVV71_RS04400 (NVV71_04400) addB 778972..782445 (+) 3474 WP_070753848.1 helicase-exonuclease AddAB subunit AddB -
  NVV71_RS04405 (NVV71_04405) addA 782447..786154 (+) 3708 WP_070753847.1 helicase-exonuclease AddAB subunit AddA -
  NVV71_RS04410 (NVV71_04410) - 786155..787003 (+) 849 WP_070753845.1 fumarylacetoacetate hydrolase family protein -
  NVV71_RS04415 (NVV71_04415) - 787023..787385 (+) 363 WP_003769902.1 YisL family protein -
  NVV71_RS04420 (NVV71_04420) - 787469..788371 (+) 903 WP_010991142.1 YitT family protein -

Sequence


Protein


Download         Length: 159 a.a.        Molecular weight: 17766.60 Da        Isoelectric Point: 5.2955

>NTDB_id=722480 NVV71_RS04215 WP_112120314.1 752634..753113(+) (ssbA) [Listeria innocua strain F6215]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRTFTNQNGEREADFIQCVVWRKPAENVANFLKKGSLAGVDGRIQTR
NYEDNDGKRVFVTEVVAESVQFLEPRNHAEGATSNNYQNEANYSNNNKTSSYRADTSQKSDSFANEGKPIDINPDDLPF

Nucleotide


Download         Length: 480 bp        

>NTDB_id=722480 NVV71_RS04215 WP_112120314.1 752634..753113(+) (ssbA) [Listeria innocua strain F6215]
ATGATGAACCGTGTAGTACTTGTAGGACGATTAACAAAGGATCCTGAATTACGTTACACTCCAGCTGGTGTGGCCGTTGC
GACTTTTACATTAGCTGTAAACCGCACTTTCACTAATCAGAATGGAGAACGAGAAGCCGACTTTATTCAATGTGTTGTTT
GGCGTAAACCAGCGGAAAACGTAGCTAATTTCTTAAAAAAAGGAAGCTTGGCAGGCGTCGATGGACGCATACAGACTCGA
AATTACGAAGATAACGACGGTAAACGCGTTTTTGTTACAGAAGTAGTAGCTGAATCAGTTCAATTCTTAGAGCCTAGAAA
CCACGCAGAAGGCGCTACATCGAATAATTATCAAAACGAGGCTAATTATTCAAATAACAATAAAACAAGCTCATATCGAG
CGGATACGAGTCAGAAGAGCGATTCATTTGCGAATGAAGGTAAGCCGATTGATATTAATCCGGATGATTTACCATTTTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

65.698

100

0.711

  ssb Latilactobacillus sakei subsp. sakei 23K

55.882

100

0.597

  ssbB Bacillus subtilis subsp. subtilis str. 168

59.821

70.44

0.421