Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NX823_RS12710 Genome accession   NZ_CP103352
Coordinates   2390429..2390803 (-) Length   124 a.a.
NCBI ID   WP_014480253.1    Uniprot ID   A0AA96ZSW7
Organism   Bacillus subtilis strain SRCM117508     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2385429..2395803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX823_RS12670 (NX823_12670) yqhG 2385761..2386555 (+) 795 WP_014480249.1 YqhG family protein -
  NX823_RS12675 (NX823_12675) sinI 2386738..2386911 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX823_RS12680 (NX823_12680) sinR 2386945..2387280 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX823_RS12685 (NX823_12685) tasA 2387373..2388158 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NX823_RS12690 (NX823_12690) sipW 2388222..2388794 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NX823_RS12695 (NX823_12695) tapA 2388778..2389539 (-) 762 WP_258993522.1 amyloid fiber anchoring/assembly protein TapA -
  NX823_RS12700 (NX823_12700) yqzG 2389811..2390137 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX823_RS12705 (NX823_12705) spoIITA 2390179..2390358 (-) 180 WP_014480252.1 YqzE family protein -
  NX823_RS12710 (NX823_12710) comGG 2390429..2390803 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NX823_RS12715 (NX823_12715) comGF 2390804..2391187 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NX823_RS12720 (NX823_12720) comGE 2391213..2391560 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NX823_RS12725 (NX823_12725) comGD 2391544..2391975 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  NX823_RS12730 (NX823_12730) comGC 2391965..2392261 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NX823_RS12735 (NX823_12735) comGB 2392275..2393312 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  NX823_RS12740 (NX823_12740) comGA 2393299..2394369 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NX823_RS12745 (NX823_12745) - 2394581..2394778 (-) 198 WP_014480259.1 CBS domain-containing protein -
  NX823_RS12750 (NX823_12750) corA 2394780..2395733 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence

Protein


Download         Length: 124 a.a.        Molecular weight: 14509.72 Da        Isoelectric Point: 9.2806

>NTDB_id=722299 NX823_RS12710 WP_014480253.1 2390429..2390803(-) (comGG) [Bacillus subtilis strain SRCM117508]
MYRTRGFIYPAVLFVSALVLLIVNFAAAQYISRCMFEKETKELYIGENLLQNGVLLSIRHVLEERKGQEGTQQFPYGRVS
YYIHDTSIKEQKEINLRVSTESGTERTAQIVFDQKQKKLLRWTE

Nucleotide


Download         Length: 375 bp        

>NTDB_id=722299 NX823_RS12710 WP_014480253.1 2390429..2390803(-) (comGG) [Bacillus subtilis strain SRCM117508]
ATGTATCGTACAAGAGGGTTTATTTATCCAGCTGTTCTTTTTGTGTCAGCGCTTGTGCTGTTAATCGTGAACTTTGCTGC
TGCTCAATATATTTCACGCTGCATGTTTGAAAAGGAAACAAAAGAGTTATACATAGGAGAGAATTTGCTTCAAAATGGGG
TGCTTCTTTCGATTCGGCATGTTCTAGAGGAACGGAAAGGCCAGGAGGGTACGCAGCAATTTCCATATGGACGGGTTTCT
TATTACATTCATGATACATCGATAAAAGAACAAAAAGAAATCAACTTAAGAGTGTCAACGGAGTCGGGAACAGAAAGAAC
TGCACAGATCGTATTTGATCAAAAACAGAAAAAACTGCTGAGATGGACAGAATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

97.581

100

0.976