Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NX823_RS12675 Genome accession   NZ_CP103352
Coordinates   2386738..2386911 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis strain SRCM117508     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2381738..2391911
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX823_RS12660 (NX823_12660) gcvT 2382537..2383625 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  NX823_RS12665 (NX823_12665) hepAA 2384067..2385740 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  NX823_RS12670 (NX823_12670) yqhG 2385761..2386555 (+) 795 WP_014480249.1 YqhG family protein -
  NX823_RS12675 (NX823_12675) sinI 2386738..2386911 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NX823_RS12680 (NX823_12680) sinR 2386945..2387280 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NX823_RS12685 (NX823_12685) tasA 2387373..2388158 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NX823_RS12690 (NX823_12690) sipW 2388222..2388794 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NX823_RS12695 (NX823_12695) tapA 2388778..2389539 (-) 762 WP_258993522.1 amyloid fiber anchoring/assembly protein TapA -
  NX823_RS12700 (NX823_12700) yqzG 2389811..2390137 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NX823_RS12705 (NX823_12705) spoIITA 2390179..2390358 (-) 180 WP_014480252.1 YqzE family protein -
  NX823_RS12710 (NX823_12710) comGG 2390429..2390803 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NX823_RS12715 (NX823_12715) comGF 2390804..2391187 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NX823_RS12720 (NX823_12720) comGE 2391213..2391560 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=722297 NX823_RS12675 WP_003230187.1 2386738..2386911(+) (sinI) [Bacillus subtilis strain SRCM117508]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=722297 NX823_RS12675 WP_003230187.1 2386738..2386911(+) (sinI) [Bacillus subtilis strain SRCM117508]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1