Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NX819_RS16645 Genome accession   NZ_CP103351
Coordinates   3191095..3191235 (-) Length   46 a.a.
NCBI ID   WP_003220708.1    Uniprot ID   G4P060
Organism   Bacillus subtilis strain SRCM115947     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3186095..3196235
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX819_RS16620 (NX819_16620) yuxO 3186407..3186787 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NX819_RS16625 (NX819_16625) comA 3186806..3187450 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NX819_RS16630 (NX819_16630) comP 3187531..3189841 (-) 2311 Protein_3212 two-component system sensor histidine kinase ComP -
  NX819_RS16635 (NX819_16635) comX 3189856..3190023 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NX819_RS16640 (NX819_16640) comQ 3190011..3190910 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NX819_RS16645 (NX819_16645) degQ 3191095..3191235 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NX819_RS16650 (NX819_16650) - 3191457..3191582 (+) 126 WP_003228793.1 hypothetical protein -
  NX819_RS16655 (NX819_16655) - 3191696..3192064 (+) 369 WP_003243784.1 hypothetical protein -
  NX819_RS16660 (NX819_16660) pdeH 3192040..3193269 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NX819_RS16665 (NX819_16665) pncB 3193406..3194878 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -
  NX819_RS16670 (NX819_16670) pncA 3194894..3195445 (-) 552 WP_003243099.1 cysteine hydrolase family protein -
  NX819_RS16675 (NX819_16675) yueI 3195542..3195940 (-) 399 WP_003242987.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5546.44 Da        Isoelectric Point: 6.2559

>NTDB_id=722243 NX819_RS16645 WP_003220708.1 3191095..3191235(-) (degQ) [Bacillus subtilis strain SRCM115947]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYNYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=722243 NX819_RS16645 WP_003220708.1 3191095..3191235(-) (degQ) [Bacillus subtilis strain SRCM115947]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAACTCGATAAATACAATTATGCAATGAAAATTTCGTGA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB G4P060

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

100

100

1