Detailed information    

insolico Bioinformatically predicted

Overview


Name   comX   Type   Regulator
Locus tag   NX819_RS16635 Genome accession   NZ_CP103351
Coordinates   3189856..3190023 (-) Length   55 a.a.
NCBI ID   WP_003242801.1    Uniprot ID   G9LQ80
Organism   Bacillus subtilis strain SRCM115947     
Function   binding to ComP; trigger autophosphorylation of ComP (predicted from homology)   
Competence regulation

Genomic Context


Location: 3184856..3195023
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NX819_RS16605 (NX819_16605) mrpE 3185250..3185726 (+) 477 WP_003228815.1 Na+/H+ antiporter subunit E -
  NX819_RS16610 (NX819_16610) mrpF 3185726..3186010 (+) 285 WP_003228814.1 Na(+)/H(+) antiporter subunit F1 -
  NX819_RS16615 (NX819_16615) mnhG 3185994..3186368 (+) 375 WP_003244302.1 monovalent cation/H(+) antiporter subunit G -
  NX819_RS16620 (NX819_16620) yuxO 3186407..3186787 (-) 381 WP_003228810.1 hotdog fold thioesterase -
  NX819_RS16625 (NX819_16625) comA 3186806..3187450 (-) 645 WP_003220716.1 two-component system response regulator ComA Regulator
  NX819_RS16630 (NX819_16630) comP 3187531..3189841 (-) 2311 Protein_3212 two-component system sensor histidine kinase ComP -
  NX819_RS16635 (NX819_16635) comX 3189856..3190023 (-) 168 WP_003242801.1 competence pheromone ComX Regulator
  NX819_RS16640 (NX819_16640) comQ 3190011..3190910 (-) 900 WP_003243039.1 ComX modifying isoprenyl transferase ComQ Regulator
  NX819_RS16645 (NX819_16645) degQ 3191095..3191235 (-) 141 WP_003220708.1 degradation enzyme regulation protein DegQ Regulator
  NX819_RS16650 (NX819_16650) - 3191457..3191582 (+) 126 WP_003228793.1 hypothetical protein -
  NX819_RS16655 (NX819_16655) - 3191696..3192064 (+) 369 WP_003243784.1 hypothetical protein -
  NX819_RS16660 (NX819_16660) pdeH 3192040..3193269 (-) 1230 WP_003243525.1 cyclic di-GMP phosphodiesterase -
  NX819_RS16665 (NX819_16665) pncB 3193406..3194878 (-) 1473 WP_003228788.1 nicotinate phosphoribosyltransferase -

Sequence


Protein


Download         Length: 55 a.a.        Molecular weight: 6518.42 Da        Isoelectric Point: 4.3285

>NTDB_id=722241 NX819_RS16635 WP_003242801.1 3189856..3190023(-) (comX) [Bacillus subtilis strain SRCM115947]
MQDLINYFLNYPEALKKLKNKEACLIGFDVQETETIIKAYNDYYLADPITRQWGD

Nucleotide


Download         Length: 168 bp        

>NTDB_id=722241 NX819_RS16635 WP_003242801.1 3189856..3190023(-) (comX) [Bacillus subtilis strain SRCM115947]
ATGCAAGACCTAATTAACTACTTTTTAAATTATCCTGAGGCTTTAAAAAAATTGAAAAATAAAGAAGCCTGCCTTATAGG
TTTTGATGTGCAAGAAACTGAAACAATAATTAAAGCTTATAATGATTATTATCTGGCTGATCCAATAACCCGTCAATGGG
GTGATTAA

Domains



No domain identified.



Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure
  AlphaFold DB G9LQ80

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comX Bacillus subtilis subsp. subtilis str. 168

100

100

1