Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NWE25_RS14995 Genome accession   NZ_CP102866
Coordinates   3090007..3090147 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain YS-AT-DS1     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3085007..3095147
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NWE25_RS14970 (NWE25_14970) - 3085347..3085730 (-) 384 WP_007613430.1 hotdog fold thioesterase -
  NWE25_RS14975 (NWE25_14975) comA 3085752..3086396 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  NWE25_RS14980 (NWE25_14980) comP 3086477..3088768 (-) 2292 WP_038459663.1 histidine kinase Regulator
  NWE25_RS14985 (NWE25_14985) comX 3088780..3088944 (-) 165 WP_007613432.1 competence pheromone ComX -
  NWE25_RS14990 (NWE25_14990) - 3088944..3089855 (-) 912 WP_079891857.1 polyprenyl synthetase family protein -
  NWE25_RS14995 (NWE25_14995) degQ 3090007..3090147 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  NWE25_RS15000 (NWE25_15000) - 3090613..3090954 (+) 342 WP_038459666.1 hypothetical protein -
  NWE25_RS15005 (NWE25_15005) - 3090961..3092184 (-) 1224 WP_032876792.1 EAL and HDOD domain-containing protein -
  NWE25_RS15010 (NWE25_15010) - 3092314..3093780 (-) 1467 WP_014418767.1 nicotinate phosphoribosyltransferase -
  NWE25_RS15015 (NWE25_15015) - 3093798..3094349 (-) 552 WP_003152033.1 cysteine hydrolase family protein -
  NWE25_RS15020 (NWE25_15020) - 3094446..3094844 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=719445 NWE25_RS14995 WP_003152043.1 3090007..3090147(-) (degQ) [Bacillus velezensis strain YS-AT-DS1]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=719445 NWE25_RS14995 WP_003152043.1 3090007..3090147(-) (degQ) [Bacillus velezensis strain YS-AT-DS1]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891