Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   IL310_RS02895 Genome accession   NZ_CP117409
Coordinates   177216..177500 (+) Length   94 a.a.
NCBI ID   WP_025017139.1    Uniprot ID   -
Organism   Lactococcus lactis strain LB7     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 172216..182500
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  IL310_RS02865 (IL310_02870) comGA 173807..174745 (+) 939 WP_058206479.1 competence type IV pilus ATPase ComGA Machinery gene
  IL310_RS02870 (IL310_02875) comGB 174639..175712 (+) 1074 WP_201248649.1 competence type IV pilus assembly protein ComGB Machinery gene
  IL310_RS02875 (IL310_02880) comGC 175726..176109 (+) 384 WP_012898622.1 competence type IV pilus major pilin ComGC Machinery gene
  IL310_RS02880 (IL310_02885) comGD 176069..176500 (+) 432 WP_012898621.1 competence type IV pilus minor pilin ComGD Machinery gene
  IL310_RS02885 (IL310_02890) comGE 176472..176768 (+) 297 WP_033900709.1 competence type IV pilus minor pilin ComGE Machinery gene
  IL310_RS02890 (IL310_02895) comGF 176731..177177 (+) 447 WP_201248646.1 competence type IV pilus minor pilin ComGF Machinery gene
  IL310_RS02895 (IL310_02900) comGG 177216..177500 (+) 285 WP_025017139.1 competence type IV pilus minor pilin ComGG Machinery gene
  IL310_RS02900 (IL310_02905) - 177582..178019 (+) 438 WP_201248645.1 zinc-dependent MarR family transcriptional regulator -
  IL310_RS02905 (IL310_02910) - 178016..178858 (+) 843 WP_015427160.1 metal ABC transporter substrate-binding protein -
  IL310_RS02910 (IL310_02915) - 179035..179772 (+) 738 WP_201248644.1 metal ABC transporter ATP-binding protein -
  IL310_RS02915 (IL310_02920) - 179765..180574 (+) 810 WP_014570791.1 metal ABC transporter permease -
  IL310_RS02920 (IL310_02925) - 180612..181478 (-) 867 WP_025017140.1 RluA family pseudouridine synthase -
  IL310_RS02925 (IL310_02930) - 181683..182060 (+) 378 WP_003129983.1 pyridoxamine 5'-phosphate oxidase family protein -

Sequence

Protein


Download         Length: 94 a.a.        Molecular weight: 10813.05 Da        Isoelectric Point: 5.0604

>NTDB_id=717996 IL310_RS02895 WP_025017139.1 177216..177500(+) (comGG) [Lactococcus lactis strain LB7]
MFSMFLQFYLERQIDDARQLRSEKEQLTAELMVSVALKTDLKSQGQIHFDSGDLSYNLLTDSSASSKITDHSSDENTYQF
SIHLKDGTNFQIKK

Nucleotide


Download         Length: 285 bp        

>NTDB_id=717996 IL310_RS02895 WP_025017139.1 177216..177500(+) (comGG) [Lactococcus lactis strain LB7]
ATGTTTTCAATGTTTCTTCAGTTCTATTTGGAAAGGCAAATAGATGATGCTCGACAATTAAGAAGTGAAAAGGAGCAGTT
AACAGCTGAATTAATGGTGTCAGTAGCTTTAAAGACTGATTTAAAATCTCAAGGTCAAATTCATTTTGATTCAGGGGATT
TGTCCTACAATTTACTGACAGACTCGTCAGCTAGTTCAAAAATTACTGACCATTCAAGTGATGAAAATACCTATCAATTT
AGTATCCATCTAAAAGATGGCACAAACTTTCAAATAAAAAAATAA

Domains


No domain identified.



Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Lactococcus lactis subsp. cremoris KW2

58.511

100

0.585