Detailed information    

insolico Bioinformatically predicted

Overview

Name   comC/blpC   Type   Regulator
Locus tag   NPS16_RS08715 Genome accession   NZ_CP101986
Coordinates   1842312..1842452 (+) Length   46 a.a.
NCBI ID   WP_002270250.1    Uniprot ID   Q9APK7
Organism   Streptococcus mutans strain COCC33-14     
Function   binding to ComD; induce autophosphorylation of ComD; regulation of comX expression (predicted from homology)   
Competence regulation

Genomic Context

Location: 1837312..1847452
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPS16_RS08690 (NPS16_08690) comB 1838266..1839138 (+) 873 WP_374684427.1 HlyD family efflux transporter periplasmic adaptor subunit Regulator
  NPS16_RS10135 comB 1839128..1839280 (+) 153 WP_372552041.1 hypothetical protein Regulator
  NPS16_RS08695 (NPS16_08695) - 1839541..1839684 (-) 144 WP_002263740.1 hypothetical protein -
  NPS16_RS08700 (NPS16_08700) - 1839976..1840998 (-) 1023 WP_258968990.1 thioredoxin family protein -
  NPS16_RS08705 (NPS16_08705) - 1841483..1841671 (-) 189 WP_002270918.1 Blp family class II bacteriocin -
  NPS16_RS08710 (NPS16_08710) - 1841835..1842047 (-) 213 WP_002264173.1 Blp family class II bacteriocin -
  NPS16_RS08715 (NPS16_08715) comC/blpC 1842312..1842452 (+) 141 WP_002270250.1 ComC/BlpC family leader-containing pheromone/bacteriocin Regulator
  NPS16_RS08720 (NPS16_08720) comD/blpH 1842594..1843919 (-) 1326 WP_002267940.1 sensor histidine kinase Regulator
  NPS16_RS08725 (NPS16_08725) comE/blpR 1843916..1844668 (-) 753 WP_002270252.1 response regulator transcription factor Regulator
  NPS16_RS08730 (NPS16_08730) - 1845139..1845777 (-) 639 WP_002271525.1 VTT domain-containing protein -
  NPS16_RS08735 (NPS16_08735) - 1845825..1846451 (-) 627 WP_002273094.1 hypothetical protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5195.02 Da        Isoelectric Point: 10.4929

>NTDB_id=713670 NPS16_RS08715 WP_002270250.1 1842312..1842452(+) (comC/blpC) [Streptococcus mutans strain COCC33-14]
MKKTPSLKNDFKEIKTDELEIIIGGSGSLSTFFRLFNRSFTQALGK

Nucleotide


Download         Length: 141 bp        

>NTDB_id=713670 NPS16_RS08715 WP_002270250.1 1842312..1842452(+) (comC/blpC) [Streptococcus mutans strain COCC33-14]
ATGAAAAAAACACCATCATTAAAAAATGACTTTAAAGAAATTAAGACTGATGAATTAGAGATTATCATTGGCGGAAGCGG
AAGCCTATCAACATTTTTCCGGCTGTTTAACAGAAGTTTTACACAAGCTTTGGGAAAATAA

Domains

Predicted by InterproScan.

COMC family (ComC)

(1-32)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB Q9APK7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comC/blpC Streptococcus mutans UA159

97.826

100

0.978