Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NP436_RS12710 Genome accession   NZ_CP101932
Coordinates   2363774..2364157 (-) Length   127 a.a.
NCBI ID   WP_014480254.1    Uniprot ID   -
Organism   Bacillus subtilis subsp. natto strain BGSC 27E1     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2358774..2369157
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP436_RS12670 (NP436_12670) sinI 2359708..2359881 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP436_RS12675 (NP436_12675) sinR 2359915..2360250 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP436_RS12680 (NP436_12680) tasA 2360343..2361128 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NP436_RS12685 (NP436_12685) sipW 2361192..2361764 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NP436_RS12690 (NP436_12690) tapA 2361748..2362509 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NP436_RS12695 (NP436_12695) yqzG 2362781..2363107 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP436_RS12700 (NP436_12700) spoIITA 2363149..2363328 (-) 180 WP_014480252.1 YqzE family protein -
  NP436_RS12705 (NP436_12705) comGG 2363399..2363773 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NP436_RS12710 (NP436_12710) comGF 2363774..2364157 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NP436_RS12715 (NP436_12715) comGE 2364183..2364530 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene
  NP436_RS12720 (NP436_12720) comGD 2364514..2364945 (-) 432 WP_014480256.1 comG operon protein ComGD Machinery gene
  NP436_RS12725 (NP436_12725) comGC 2364935..2365231 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NP436_RS12730 (NP436_12730) comGB 2365245..2366282 (-) 1038 WP_031600685.1 comG operon protein ComGB Machinery gene
  NP436_RS12735 (NP436_12735) comGA 2366269..2367339 (-) 1071 WP_004399124.1 competence protein ComGA Machinery gene
  NP436_RS12740 (NP436_12740) - 2367551..2367748 (-) 198 WP_014480259.1 CBS domain-containing protein -
  NP436_RS12745 (NP436_12745) corA 2367750..2368703 (-) 954 WP_014480260.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14329.42 Da        Isoelectric Point: 5.8949

>NTDB_id=713163 NP436_RS12710 WP_014480254.1 2363774..2364157(-) (comGF) [Bacillus subtilis subsp. natto strain BGSC 27E1]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFEIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=713163 NP436_RS12710 WP_014480254.1 2363774..2364157(-) (comGF) [Bacillus subtilis subsp. natto strain BGSC 27E1]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTGTCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAGTCACAGGCAGTTAAGACAGCCGAGCATGGGAGCG
TGTTAATCTGCACCAATCTTTCCGGGCAGGACATCCGTTTCGAAATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

98.425

100

0.984