Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NP436_RS12670 Genome accession   NZ_CP101932
Coordinates   2359708..2359881 (+) Length   57 a.a.
NCBI ID   WP_003230187.1    Uniprot ID   A0A063X7W9
Organism   Bacillus subtilis subsp. natto strain BGSC 27E1     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2354708..2364881
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP436_RS12655 (NP436_12655) gcvT 2355507..2356595 (-) 1089 WP_014480247.1 glycine cleavage system aminomethyltransferase GcvT -
  NP436_RS12660 (NP436_12660) hepAA 2357037..2358710 (+) 1674 WP_014480248.1 DEAD/DEAH box helicase -
  NP436_RS12665 (NP436_12665) yqhG 2358731..2359525 (+) 795 WP_014480249.1 YqhG family protein -
  NP436_RS12670 (NP436_12670) sinI 2359708..2359881 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP436_RS12675 (NP436_12675) sinR 2359915..2360250 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP436_RS12680 (NP436_12680) tasA 2360343..2361128 (-) 786 WP_014480250.1 biofilm matrix protein TasA -
  NP436_RS12685 (NP436_12685) sipW 2361192..2361764 (-) 573 WP_003230181.1 signal peptidase I SipW -
  NP436_RS12690 (NP436_12690) tapA 2361748..2362509 (-) 762 WP_014480251.1 amyloid fiber anchoring/assembly protein TapA -
  NP436_RS12695 (NP436_12695) yqzG 2362781..2363107 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP436_RS12700 (NP436_12700) spoIITA 2363149..2363328 (-) 180 WP_014480252.1 YqzE family protein -
  NP436_RS12705 (NP436_12705) comGG 2363399..2363773 (-) 375 WP_014480253.1 ComG operon protein ComGG Machinery gene
  NP436_RS12710 (NP436_12710) comGF 2363774..2364157 (-) 384 WP_014480254.1 ComG operon protein ComGF Machinery gene
  NP436_RS12715 (NP436_12715) comGE 2364183..2364530 (-) 348 WP_014480255.1 ComG operon protein 5 Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6601.52 Da        Isoelectric Point: 6.7231

>NTDB_id=713160 NP436_RS12670 WP_003230187.1 2359708..2359881(+) (sinI) [Bacillus subtilis subsp. natto strain BGSC 27E1]
MKNAKQEHFELDQEWVELMVEAKEANISPEEIRKYLLLNKKSAHPGPAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=713160 NP436_RS12670 WP_003230187.1 2359708..2359881(+) (sinI) [Bacillus subtilis subsp. natto strain BGSC 27E1]
ATGAAGAATGCAAAACAAGAGCACTTTGAATTGGATCAAGAATGGGTTGAATTAATGGTGGAAGCCAAAGAGGCAAATAT
CAGCCCGGAAGAAATACGAAAATATTTACTTTTAAACAAAAAGTCTGCTCATCCTGGTCCGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-36)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A063X7W9

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

100

100

1