Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGF   Type   Machinery gene
Locus tag   NP432_RS12305 Genome accession   NZ_CP101931
Coordinates   2424383..2424766 (-) Length   127 a.a.
NCBI ID   WP_032726158.1    Uniprot ID   A0AAX3RJE0
Organism   Bacillus subtilis strain BGSC b98af     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 2419383..2429766
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NP432_RS12265 (NP432_12265) sinI 2420316..2420489 (+) 174 WP_003230187.1 anti-repressor SinI Regulator
  NP432_RS12270 (NP432_12270) sinR 2420523..2420858 (+) 336 WP_003226345.1 transcriptional regulator SinR Regulator
  NP432_RS12275 (NP432_12275) tasA 2420951..2421736 (-) 786 WP_212130175.1 biofilm matrix protein TasA -
  NP432_RS12280 (NP432_12280) sipW 2421800..2422372 (-) 573 WP_003246088.1 signal peptidase I SipW -
  NP432_RS12285 (NP432_12285) tapA 2422356..2423117 (-) 762 WP_015251716.1 amyloid fiber anchoring/assembly protein TapA -
  NP432_RS12290 (NP432_12290) yqzG 2423389..2423715 (+) 327 WP_003246051.1 YqzG/YhdC family protein -
  NP432_RS12295 (NP432_12295) spoIITA 2423757..2423936 (-) 180 WP_029726723.1 YqzE family protein -
  NP432_RS12300 (NP432_12300) comGG 2424008..2424382 (-) 375 WP_167408283.1 ComG operon protein ComGG Machinery gene
  NP432_RS12305 (NP432_12305) comGF 2424383..2424766 (-) 384 WP_032726158.1 ComG operon protein ComGF Machinery gene
  NP432_RS12310 (NP432_12310) comGE 2424792..2425139 (-) 348 WP_021480020.1 ComG operon protein 5 Machinery gene
  NP432_RS12315 (NP432_12315) comGD 2425123..2425554 (-) 432 WP_256682874.1 comG operon protein ComGD Machinery gene
  NP432_RS12320 (NP432_12320) comGC 2425544..2425840 (-) 297 WP_003230162.1 comG operon protein ComGC Machinery gene
  NP432_RS12325 (NP432_12325) comGB 2425854..2426891 (-) 1038 WP_116316545.1 comG operon protein ComGB Machinery gene
  NP432_RS12330 (NP432_12330) comGA 2426878..2427948 (-) 1071 WP_015714258.1 competence protein ComGA Machinery gene
  NP432_RS12335 (NP432_12335) corA 2428360..2429313 (-) 954 WP_256682875.1 magnesium transporter CorA -

Sequence


Protein


Download         Length: 127 a.a.        Molecular weight: 14315.39 Da        Isoelectric Point: 5.8929

>NTDB_id=713085 NP432_RS12305 WP_032726158.1 2424383..2424766(-) (comGF) [Bacillus subtilis strain BGSC b98af]
MLISGSLAAIFHLFLSRQQEHDGFTQQEWMISIEQMMNECKESQAVKTAEHGSVLICTNLSGQDIRFDIYHSMIRKRVDG
KGHVPILDHITAMKADIENGVVLLKIESEDQKVYQTAFPVYSYLGGG

Nucleotide


Download         Length: 384 bp        

>NTDB_id=713085 NP432_RS12305 WP_032726158.1 2424383..2424766(-) (comGF) [Bacillus subtilis strain BGSC b98af]
TTGCTCATATCAGGATCGTTAGCTGCGATTTTCCATCTGTTTTTATCTCGACAGCAGGAACATGACGGTTTCACACAGCA
AGAATGGATGATTTCGATAGAACAGATGATGAATGAATGCAAGGAATCACAGGCAGTTAAGACAGCCGAGCATGGGAGTG
TGTTAATCTGCACCAATCTTTCCGGACAAGACATCCGTTTTGACATTTATCATTCAATGATAAGAAAAAGAGTGGATGGC
AAAGGGCATGTTCCGATTTTAGATCATATTACTGCCATGAAAGCTGATATTGAAAATGGTGTTGTTTTGCTGAAAATTGA
GAGTGAGGACCAAAAAGTGTATCAAACTGCTTTTCCAGTCTATTCGTATTTAGGAGGGGGGTGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGF Bacillus subtilis subsp. subtilis str. 168

99.213

100

0.992