Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NPA43_RS14325 Genome accession   NZ_CP101833
Coordinates   2789945..2790085 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus pumilus strain NDY-10     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 2784945..2795085
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPA43_RS14300 (NPA43_14300) - 2785208..2785597 (-) 390 WP_256498984.1 hotdog fold thioesterase -
  NPA43_RS14305 (NPA43_14305) comA 2785621..2786262 (-) 642 WP_058013793.1 response regulator transcription factor Regulator
  NPA43_RS14310 (NPA43_14310) comP 2786343..2788655 (-) 2313 WP_256498986.1 ATP-binding protein Regulator
  NPA43_RS14315 (NPA43_14315) comX 2788709..2788879 (-) 171 WP_099727085.1 competence pheromone ComX -
  NPA43_RS14320 (NPA43_14320) - 2788876..2789793 (-) 918 WP_099727084.1 polyprenyl synthetase family protein -
  NPA43_RS14325 (NPA43_14325) degQ 2789945..2790085 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NPA43_RS14330 (NPA43_14330) - 2790633..2790944 (+) 312 WP_230030804.1 inner spore coat protein -
  NPA43_RS14335 (NPA43_14335) - 2791067..2792293 (-) 1227 WP_230030881.1 EAL and HDOD domain-containing protein -
  NPA43_RS14340 (NPA43_14340) - 2792432..2793901 (-) 1470 WP_099727081.1 nicotinate phosphoribosyltransferase -
  NPA43_RS14345 (NPA43_14345) - 2793919..2794470 (-) 552 WP_099727080.1 cysteine hydrolase family protein -
  NPA43_RS14350 (NPA43_14350) - 2794531..2794938 (-) 408 WP_099727079.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=712250 NPA43_RS14325 WP_003213123.1 2789945..2790085(-) (degQ) [Bacillus pumilus strain NDY-10]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=712250 NPA43_RS14325 WP_003213123.1 2789945..2790085(-) (degQ) [Bacillus pumilus strain NDY-10]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAATTATTGTGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696