Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NPA28_RS16050 Genome accession   NZ_CP101718
Coordinates   3150946..3151086 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain S-5     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3145946..3156086
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NPA28_RS16025 (NPA28_16025) - 3146257..3146637 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  NPA28_RS16030 (NPA28_16030) comA 3146655..3147299 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  NPA28_RS16035 (NPA28_16035) comP 3147380..3149689 (-) 2310 WP_213417883.1 two-component system sensor histidine kinase ComP Regulator
  NPA28_RS16040 (NPA28_16040) comX 3149705..3149872 (-) 168 WP_044158946.1 competence pheromone ComX Regulator
  NPA28_RS16045 (NPA28_16045) comQ 3149856..3150761 (-) 906 WP_044160315.1 polyprenyl synthetase family protein Regulator
  NPA28_RS16050 (NPA28_16050) degQ 3150946..3151086 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  NPA28_RS16055 (NPA28_16055) - 3151547..3151915 (+) 369 WP_044158947.1 hypothetical protein -
  NPA28_RS16060 (NPA28_16060) - 3151891..3153120 (-) 1230 WP_044158949.1 EAL and HDOD domain-containing protein -
  NPA28_RS16065 (NPA28_16065) - 3153256..3154725 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  NPA28_RS16070 (NPA28_16070) - 3154741..3155292 (-) 552 WP_256766352.1 cysteine hydrolase family protein -
  NPA28_RS16075 (NPA28_16075) - 3155389..3155787 (-) 399 WP_256766353.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=711786 NPA28_RS16050 WP_024122683.1 3150946..3151086(-) (degQ) [Bacillus halotolerans strain S-5]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=711786 NPA28_RS16050 WP_024122683.1 3150946..3151086(-) (degQ) [Bacillus halotolerans strain S-5]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978