Detailed information NTG0711536

Bioinformatically predicted

Overview

• Name: comGF
• Type: Machinery gene
• Locus tag: POF58_RS01150
• Genome accession: NZ_CP116711
• Coordinates: 192146..192607 (+)
• Length: 153 a.a.
• NCBI ID: WP_001874060.1
• Uniprot ID: -
• Organism: Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant
• Function: dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology) DNA binding and uptake

Genomic Context

Location: 187146..197607

Locus tag	Gene name	Coordinates (strand)	Size (bp)	Protein ID	Product	Description
POF58_RS01120 (POF58_01120)	-	188762..189127 (+)	366	WP_000285373.1	DUF1033 family protein	-
POF58_RS01125 (POF58_01125)	comGA	189299..190270 (+)	972	WP_000250801.1	competence type IV pilus ATPase ComGA	Machinery gene
POF58_RS01130 (POF58_01130)	comGB	190164..191207 (+)	1044	WP_228313184.1	competence type IV pilus assembly protein ComGB	Machinery gene
POF58_RS01135 (POF58_01135)	comGC/cglC	191204..191533 (+)	330	WP_000793380.1	competence type IV pilus major pilin ComGC	Machinery gene
POF58_RS01140 (POF58_01140)	comGD	191508..191921 (+)	414	WP_000244259.1	competence type IV pilus minor pilin ComGD	Machinery gene
POF58_RS01145 (POF58_01145)	comGE	191893..192192 (+)	300	WP_038406052.1	competence type IV pilus minor pilin ComGE	Machinery gene
POF58_RS01150 (POF58_01150)	comGF	192146..192607 (+)	462	WP_001874060.1	competence type IV pilus minor pilin ComGF	Machinery gene
POF58_RS01155 (POF58_01155)	comGG	192585..192956 (+)	372	WP_000601105.1	competence type IV pilus minor pilin ComGG	Machinery gene
POF58_RS01160 (POF58_01160)	comGH	193071..194045 (+)	975	WP_001008567.1	class I SAM-dependent methyltransferase	Machinery gene
POF58_RS01165 (POF58_01165)	-	194077..195270 (+)	1194	WP_000047534.1	acetate kinase	-
POF58_RS01170 (POF58_01170)	-	195398..195590 (+)	193	Protein_174	helix-turn-helix transcriptional regulator	-
POF58_RS01175 (POF58_01175)	-	195569..195835 (+)	267	Protein_175	hypothetical protein	-
POF58_RS01180 (POF58_01180)	-	195904..196569 (+)	666	WP_000008107.1	type II CAAX endopeptidase family protein	-
POF58_RS01185 (POF58_01185)	proC	196590..197360 (-)	771	WP_001876660.1	pyrroline-5-carboxylate reductase	-

Sequence

Protein

• Length: 153 a.a.
• Molecular weight: 17861.86 Da
• Isoelectric Point: 9.8392

>NTDB_id=711536 POF58_RS01150 WP_001874060.1 192146..192607(+) (comGF) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant]
MKVIRKFCTYQKLRVKAFTLLECLVALVTITGALLVYQGLTKLLAQQIVVMSSSSQSEWVLLTQQLNAEFEGAHLEYLRQ
NKLYLRKQDKIVTFGKSNKDDFRKTGYDGRGYQPMVYGLDNCQMSQTKSMVKLVFYFKDGLKRTFYYDFKEET

Nucleotide

• Length: 462 bp

>NTDB_id=711536 POF58_RS01150 WP_001874060.1 192146..192607(+) (comGF) [Streptococcus agalactiae strain CNCTC 10/84 Cas9 AEKOrevertant]
TTGAAGGTAATAAGGAAATTTTGCACGTATCAAAAGTTAAGGGTTAAAGCATTTACGCTTTTAGAATGTTTGGTAGCATT
GGTTACAATCACAGGAGCTTTGCTAGTTTATCAAGGACTAACAAAATTGTTGGCTCAACAGATAGTAGTGATGTCTTCTT
CCAGTCAGTCTGAATGGGTGTTATTAACTCAGCAACTAAATGCAGAATTCGAAGGCGCTCACTTGGAATATTTAAGACAG
AACAAACTTTATTTACGTAAGCAAGATAAGATTGTAACCTTTGGCAAATCTAATAAAGATGATTTTCGTAAGACAGGTTA
TGATGGTCGAGGTTATCAACCAATGGTTTATGGGTTAGACAATTGTCAAATGAGTCAAACCAAAAGTATGGTAAAACTTG
TTTTTTATTTTAAGGACGGGTTAAAAAGGACATTTTACTATGATTTTAAAGAAGAAACTTAA

Domains

Predicted by InterProScan.

• Putative Competence protein ComGF (ComGF) (49-142)

Similar proteins

Only experimentally validated proteins are listed.

Protein	Organism	Identities (%)	Coverage (%)	Ha-value
comGF	Streptococcus mutans UA159	47.887	92.81	0.444
comGF	Streptococcus mutans UA140	47.887	92.81	0.444
comGF/cglF	Streptococcus pneumoniae Rx1	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae D39	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae R6	43.165	90.85	0.392
comGF/cglF	Streptococcus pneumoniae TIGR4	43.165	90.85	0.392
comGF/cglF	Streptococcus mitis SK321	44.03	87.582	0.386
comGF/cglF	Streptococcus mitis NCTC 12261	43.284	87.582	0.379
comGF	Lactococcus lactis subsp. cremoris KW2	40.714	91.503	0.373