Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NM232_RS05935 Genome accession   NZ_CP101399
Coordinates   1048520..1048660 (-) Length   46 a.a.
NCBI ID   WP_003213123.1    Uniprot ID   A0A5K1N966
Organism   Bacillus altitudinis strain HM-7     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 1043520..1053660
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NM232_RS05910 - 1043799..1044188 (-) 390 WP_008345855.1 hotdog fold thioesterase -
  NM232_RS05915 comA 1044212..1044853 (-) 642 WP_007500477.1 response regulator transcription factor Regulator
  NM232_RS05920 comP 1044934..1047246 (-) 2313 WP_035701206.1 ATP-binding protein Regulator
  NM232_RS05925 comX 1047287..1047457 (-) 171 WP_074041927.1 competence pheromone ComX -
  NM232_RS05930 - 1047454..1048368 (-) 915 WP_065460972.1 polyprenyl synthetase family protein -
  NM232_RS05935 degQ 1048520..1048660 (-) 141 WP_003213123.1 degradation enzyme regulation protein DegQ Regulator
  NM232_RS05940 - 1049166..1049519 (+) 354 WP_058213658.1 hypothetical protein -
  NM232_RS05945 - 1049556..1050782 (-) 1227 WP_058213657.1 EAL and HDOD domain-containing protein -
  NM232_RS05950 - 1050923..1052332 (-) 1410 WP_230677047.1 nicotinate phosphoribosyltransferase -
  NM232_RS05955 - 1052410..1052961 (-) 552 WP_008345872.1 cysteine hydrolase family protein -
  NM232_RS05960 - 1053022..1053429 (-) 408 WP_007500468.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5677.42 Da        Isoelectric Point: 4.6828

>NTDB_id=709980 NM232_RS05935 WP_003213123.1 1048520..1048660(-) (degQ) [Bacillus altitudinis strain HM-7]
MEKYEIEELKQLLWKLENEIRETTASLHNINKSIDQYDKYEYVKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=709980 NM232_RS05935 WP_003213123.1 1048520..1048660(-) (degQ) [Bacillus altitudinis strain HM-7]
ATGGAAAAGTATGAAATCGAAGAACTTAAACAACTATTATGGAAACTTGAAAACGAAATTAGAGAAACAACGGCTTCTCT
TCATAACATTAACAAAAGCATTGATCAATACGACAAATATGAATATGTGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5K1N966

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

68.085

100

0.696