Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NLV76_RS16120 Genome accession   NZ_CP100752
Coordinates   3125760..3125900 (-) Length   46 a.a.
NCBI ID   WP_254501364.1    Uniprot ID   -
Organism   Bacillus halotolerans strain MEC_B301     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3120760..3130900
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLV76_RS16095 (NLV76_16095) - 3121043..3121423 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  NLV76_RS16100 (NLV76_16100) comA 3121441..3122085 (-) 645 WP_254501360.1 two-component system response regulator ComA Regulator
  NLV76_RS16105 (NLV76_16105) comP 3122166..3124472 (-) 2307 WP_254501361.1 histidine kinase Regulator
  NLV76_RS16110 (NLV76_16110) comX 3124488..3124709 (-) 222 WP_059292642.1 competence pheromone ComX -
  NLV76_RS16115 (NLV76_16115) - 3124706..3125575 (-) 870 WP_254501363.1 polyprenyl synthetase family protein -
  NLV76_RS16120 (NLV76_16120) degQ 3125760..3125900 (-) 141 WP_254501364.1 degradation enzyme regulation protein DegQ Regulator
  NLV76_RS16125 (NLV76_16125) - 3126361..3126729 (+) 369 WP_254501365.1 hypothetical protein -
  NLV76_RS16130 (NLV76_16130) - 3126705..3127934 (-) 1230 WP_254501366.1 EAL and HDOD domain-containing protein -
  NLV76_RS16135 (NLV76_16135) - 3128070..3129539 (-) 1470 WP_254501367.1 nicotinate phosphoribosyltransferase -
  NLV76_RS16140 (NLV76_16140) - 3129555..3130106 (-) 552 WP_044158950.1 cysteine hydrolase family protein -
  NLV76_RS16145 (NLV76_16145) - 3130203..3130601 (-) 399 WP_254501368.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5519.41 Da        Isoelectric Point: 6.2559

>NTDB_id=706708 NLV76_RS16120 WP_254501364.1 3125760..3125900(-) (degQ) [Bacillus halotolerans strain MEC_B301]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQVDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=706708 NLV76_RS16120 WP_254501364.1 3125760..3125900(-) (degQ) [Bacillus halotolerans strain MEC_B301]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTATTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGGTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

95.652

100

0.957