Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   NLW79_RS16980 Genome accession   NZ_CP100651
Coordinates   3271216..3271356 (-) Length   46 a.a.
NCBI ID   WP_024122683.1    Uniprot ID   A0A9Q4HP57
Organism   Bacillus halotolerans strain MEC_B334     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3266216..3276356
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NLW79_RS16955 (NLW79_16955) - 3266499..3266879 (-) 381 WP_044158943.1 hotdog fold thioesterase -
  NLW79_RS16960 (NLW79_16960) comA 3266897..3267541 (-) 645 WP_024122680.1 two-component system response regulator ComA Regulator
  NLW79_RS16965 (NLW79_16965) comP 3267622..3269928 (-) 2307 WP_254517859.1 histidine kinase Regulator
  NLW79_RS16970 (NLW79_16970) comX 3269944..3270165 (-) 222 WP_059292642.1 competence pheromone ComX -
  NLW79_RS16975 (NLW79_16975) - 3270162..3271031 (-) 870 WP_101864136.1 polyprenyl synthetase family protein -
  NLW79_RS16980 (NLW79_16980) degQ 3271216..3271356 (-) 141 WP_024122683.1 degradation enzyme regulation protein DegQ Regulator
  NLW79_RS16985 (NLW79_16985) - 3271817..3272185 (+) 369 WP_106019478.1 hypothetical protein -
  NLW79_RS16990 (NLW79_16990) - 3272161..3273390 (-) 1230 WP_127696527.1 EAL and HDOD domain-containing protein -
  NLW79_RS16995 (NLW79_16995) - 3273526..3274995 (-) 1470 WP_024122686.1 nicotinate phosphoribosyltransferase -
  NLW79_RS17000 (NLW79_17000) - 3275011..3275562 (-) 552 WP_106019480.1 cysteine hydrolase family protein -
  NLW79_RS17005 (NLW79_17005) - 3275659..3276057 (-) 399 WP_106019481.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5533.44 Da        Isoelectric Point: 6.2559

>NTDB_id=706033 NLW79_RS16980 WP_024122683.1 3271216..3271356(-) (degQ) [Bacillus halotolerans strain MEC_B334]
MEKKLEEVKQLLFRLELDIKETTDSLRNINKSIDQLDKYTYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=706033 NLW79_RS16980 WP_024122683.1 3271216..3271356(-) (degQ) [Bacillus halotolerans strain MEC_B334]
ATGGAAAAGAAACTTGAAGAAGTAAAACAATTGTTATTCCGACTCGAACTTGATATTAAAGAAACGACAGATTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATACACATACGCAATGAAAATTTCGTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

97.826

100

0.978