Detailed information    

insolico Bioinformatically predicted

Overview


Name   comGE   Type   Machinery gene
Locus tag   H7676_RS00670 Genome accession   NZ_AP023390
Coordinates   104278..104562 (+) Length   94 a.a.
NCBI ID   WP_011284422.1    Uniprot ID   -
Organism   Streptococcus pyogenes strain KUN-0014944     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context


Location: 99278..109562
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  H7676_RS00645 (KUN4944_00790) - 101209..101574 (+) 366 WP_002986560.1 DUF1033 family protein -
  H7676_RS00650 (KUN4944_00800) comGA 101667..102620 (+) 954 WP_184492312.1 competence type IV pilus ATPase ComGA Machinery gene
  H7676_RS00655 (KUN4944_00810) comGB 102556..103590 (+) 1035 WP_226316548.1 competence type IV pilus assembly protein ComGB Machinery gene
  H7676_RS00660 (KUN4944_00820) comGC 103592..103918 (+) 327 WP_002986552.1 competence type IV pilus major pilin ComGC Machinery gene
  H7676_RS00665 (KUN4944_00830) comGD 103893..104321 (+) 429 WP_002986548.1 competence type IV pilus minor pilin ComGD Machinery gene
  H7676_RS00670 (KUN4944_00840) comGE 104278..104562 (+) 285 WP_011284422.1 competence type IV pilus minor pilin ComGE Machinery gene
  H7676_RS00675 (KUN4944_00850) comGF 104555..104989 (+) 435 WP_020904833.1 competence type IV pilus minor pilin ComGF Machinery gene
  H7676_RS00680 (KUN4944_00860) comGG 104973..105299 (+) 327 WP_002986539.1 competence type IV pilus minor pilin ComGG -
  H7676_RS00685 (KUN4944_00870) comGH 105397..106350 (+) 954 WP_010921802.1 class I SAM-dependent methyltransferase Machinery gene
  H7676_RS00690 (KUN4944_00880) - 106409..107605 (+) 1197 WP_020904834.1 acetate kinase -
  H7676_RS00695 - 107792..108100 (+) 309 Protein_90 hypothetical protein -
  H7676_RS00700 (KUN4944_00890) proC 108183..108953 (-) 771 WP_002986527.1 pyrroline-5-carboxylate reductase -

Sequence


Protein


Download         Length: 94 a.a.        Molecular weight: 10654.59 Da        Isoelectric Point: 8.9043

>NTDB_id=70518 H7676_RS00670 WP_011284422.1 104278..104562(+) (comGE) [Streptococcus pyogenes strain KUN-0014944]
MGIIKKQVKAYIALESMIATGILFSIVILVLSSLQQSQAALTYYRKQQEKLNLALMAVQTRTKEITLNGCHITILRTDRY
ISIHDDEGEVMKIE

Nucleotide


Download         Length: 285 bp        

>NTDB_id=70518 H7676_RS00670 WP_011284422.1 104278..104562(+) (comGE) [Streptococcus pyogenes strain KUN-0014944]
GTGGGAATTATCAAAAAACAAGTCAAAGCTTACATAGCCCTTGAAAGTATGATTGCAACAGGCATCCTCTTTAGTATTGT
CATTCTCGTCTTAAGCAGTTTACAGCAGAGTCAGGCTGCTCTAACGTACTATCGAAAGCAGCAAGAAAAGCTTAATCTAG
CCTTGATGGCAGTACAAACTAGAACTAAAGAGATAACATTGAATGGTTGTCATATTACTATTTTACGTACGGATAGATAC
ATTAGTATTCACGATGACGAAGGAGAAGTGATGAAGATTGAGTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGE Lactococcus lactis subsp. cremoris KW2

38.298

100

0.383


Multiple sequence alignment