Detailed information    

insolico Bioinformatically predicted

Overview


Name   dprA   Type   Machinery gene
Locus tag   JMUB898_RS08145 Genome accession   NZ_AP018587
Coordinates   1714958..1715830 (-) Length   290 a.a.
NCBI ID   WP_037541402.1    Uniprot ID   -
Organism   Staphylococcus caprae strain JMUB898     
Function   ssDNA binding; loading RecA onto ssDNA (predicted from homology)   
DNA processing

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
ICE 1672606..1750747 1714958..1715830 within 0


Gene organization within MGE regions


Location: 1672606..1750747
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  JMUB898_RS07970 (JMUB898_1605) pgsA 1673445..1674026 (-) 582 WP_002442602.1 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase -
  JMUB898_RS07975 (JMUB898_1606) - 1674058..1674450 (-) 393 WP_002442599.1 RodZ family helix-turn-helix domain-containing protein -
  JMUB898_RS07980 (JMUB898_1607) - 1674469..1675296 (-) 828 WP_002442598.1 YmfK family protein -
  JMUB898_RS07985 (JMUB898_1608) ymfI 1675481..1676185 (-) 705 WP_002442596.1 elongation factor P 5-aminopentanone reductase -
  JMUB898_RS07990 (JMUB898_1609) yfmH 1676185..1677471 (-) 1287 WP_002442594.1 EF-P 5-aminopentanol modification-associated protein YfmH -
  JMUB898_RS07995 (JMUB898_1610) yfmF 1677471..1678736 (-) 1266 WP_037541551.1 EF-P 5-aminopentanol modification-associated protein YfmF -
  JMUB898_RS08000 (JMUB898_1611) - 1678783..1679493 (-) 711 WP_002442591.1 GntR family transcriptional regulator -
  JMUB898_RS12875 - 1679496..1680947 (-) 1452 Protein_1538 DNA translocase FtsK -
  JMUB898_RS12880 - 1681046..1681907 (-) 862 Protein_1539 DNA translocase FtsK 4TM domain-containing protein -
  JMUB898_RS08010 (JMUB898_1613) rnjB 1682171..1683844 (-) 1674 WP_037541414.1 ribonuclease J2 -
  JMUB898_RS08020 (JMUB898_1614) pnp 1684085..1686184 (-) 2100 WP_049402112.1 polyribonucleotide nucleotidyltransferase -
  JMUB898_RS08025 (JMUB898_1615) rpsO 1686501..1686770 (-) 270 WP_002442583.1 30S ribosomal protein S15 -
  JMUB898_RS08030 (JMUB898_1616) ribF 1687031..1688002 (-) 972 WP_002442581.1 riboflavin biosynthesis protein RibF -
  JMUB898_RS08035 (JMUB898_1617) truB 1688018..1688935 (-) 918 WP_002442577.1 tRNA pseudouridine(55) synthase TruB -
  JMUB898_RS08040 (JMUB898_1618) rbfA 1689083..1689433 (-) 351 WP_037541413.1 30S ribosome-binding factor RbfA -
  JMUB898_RS08045 (JMUB898_1619) infB 1689595..1691760 (-) 2166 WP_126501971.1 translation initiation factor IF-2 -
  JMUB898_RS08050 (JMUB898_1620) - 1691765..1692082 (-) 318 WP_002442572.1 ribosomal L7Ae/L30e/S12e/Gadd45 family protein -
  JMUB898_RS08055 (JMUB898_1621) rnpM 1692079..1692363 (-) 285 WP_002442571.1 RNase P modulator RnpM -
  JMUB898_RS08060 (JMUB898_1622) nusA 1692380..1693591 (-) 1212 WP_002442570.1 transcription termination factor NusA -
  JMUB898_RS08065 (JMUB898_1623) rimP 1693612..1694079 (-) 468 WP_037541410.1 ribosome maturation factor RimP -
  JMUB898_RS08070 (JMUB898_1624) - 1694261..1698571 (-) 4311 WP_095323372.1 PolC-type DNA polymerase III -
  JMUB898_RS08075 (JMUB898_1625) - 1698824..1700527 (-) 1704 WP_002442566.1 proline--tRNA ligase -
  JMUB898_RS08080 (JMUB898_1626) rseP 1700547..1701833 (-) 1287 WP_002442564.1 RIP metalloprotease RseP -
  JMUB898_RS08085 (JMUB898_1627) - 1702074..1702856 (-) 783 WP_002442562.1 phosphatidate cytidylyltransferase -
  JMUB898_RS08090 (JMUB898_1628) - 1702860..1703630 (-) 771 WP_037541408.1 isoprenyl transferase -
  JMUB898_RS08095 (JMUB898_1629) frr 1703914..1704468 (-) 555 WP_002442559.1 ribosome recycling factor -
  JMUB898_RS08100 (JMUB898_1630) pyrH 1704485..1705207 (-) 723 WP_002436299.1 UMP kinase -
  JMUB898_RS08105 (JMUB898_1631) tsf 1705345..1706223 (-) 879 WP_002442557.1 translation elongation factor Ts -
  JMUB898_RS08110 (JMUB898_1632) rpsB 1706377..1707165 (-) 789 WP_002442555.1 30S ribosomal protein S2 -
  JMUB898_RS08115 (JMUB898_1633) codY 1707417..1708190 (-) 774 WP_037541406.1 GTP-sensing pleiotropic transcriptional regulator CodY -
  JMUB898_RS08120 (JMUB898_1634) hslU 1708213..1709616 (-) 1404 WP_002442550.1 ATP-dependent protease ATPase subunit HslU -
  JMUB898_RS08125 (JMUB898_1635) hslV 1709701..1710243 (-) 543 WP_002442548.1 ATP-dependent protease subunit HslV -
  JMUB898_RS08130 (JMUB898_1636) xerC 1710247..1711137 (-) 891 WP_037541405.1 tyrosine recombinase XerC -
  JMUB898_RS08135 (JMUB898_1637) trmFO 1711371..1712678 (-) 1308 WP_037541403.1 FADH(2)-oxidizing methylenetetrahydrofolate--tRNA-(uracil(54)-C(5))- methyltransferase TrmFO -
  JMUB898_RS08140 (JMUB898_1638) topA 1712705..1714780 (-) 2076 WP_167495587.1 type I DNA topoisomerase -
  JMUB898_RS08145 (JMUB898_1639) dprA 1714958..1715830 (-) 873 WP_037541402.1 DNA-processing protein DprA Machinery gene
  JMUB898_RS08150 (JMUB898_1640) sucD 1716094..1717002 (-) 909 WP_002442537.1 succinate--CoA ligase subunit alpha -
  JMUB898_RS08155 (JMUB898_1641) sucC 1717024..1718190 (-) 1167 WP_002442536.1 ADP-forming succinate--CoA ligase subunit beta -
  JMUB898_RS08160 (JMUB898_1643) - 1718298..1719068 (-) 771 WP_002442534.1 ribonuclease HII -
  JMUB898_RS08165 (JMUB898_1644) ylqF 1719052..1719936 (-) 885 WP_037541400.1 ribosome biogenesis GTPase YlqF -
  JMUB898_RS08170 (JMUB898_1645) - 1720213..1722813 (+) 2601 WP_002442530.1 YfhO family protein -
  JMUB898_RS08175 (JMUB898_1646) - 1722806..1725415 (+) 2610 WP_002442528.1 YfhO family protein -
  JMUB898_RS08180 (JMUB898_1647) rplS 1725601..1725951 (-) 351 WP_002436293.1 50S ribosomal protein L19 -
  JMUB898_RS08185 (JMUB898_1648) trmD 1726056..1726793 (-) 738 WP_002442526.1 tRNA (guanosine(37)-N1)-methyltransferase TrmD -
  JMUB898_RS08190 (JMUB898_1649) rimM 1726793..1727296 (-) 504 WP_002442524.1 ribosome maturation factor RimM -
  JMUB898_RS08195 (JMUB898_1650) rpsP 1727420..1727695 (-) 276 WP_002439483.1 30S ribosomal protein S16 -
  JMUB898_RS08200 (JMUB898_1651) ffh 1727911..1729278 (-) 1368 WP_002442522.1 signal recognition particle protein -
  JMUB898_RS08205 (JMUB898_1652) - 1729310..1729642 (-) 333 WP_002442519.1 putative DNA-binding protein -
  JMUB898_RS08210 (JMUB898_1653) ftsY 1729629..1730885 (-) 1257 WP_126501973.1 signal recognition particle-docking protein FtsY -
  JMUB898_RS08215 (JMUB898_1654) smc 1730882..1734451 (-) 3570 WP_044466284.1 chromosome segregation protein SMC -
  JMUB898_RS08220 (JMUB898_1655) rnc 1734550..1735296 (-) 747 WP_002442511.1 ribonuclease III -
  JMUB898_RS08225 (JMUB898_1656) - 1735416..1735649 (-) 234 WP_001830184.1 acyl carrier protein -
  JMUB898_RS08230 (JMUB898_1657) fabG 1735959..1736693 (-) 735 WP_037541397.1 3-oxoacyl-[acyl-carrier-protein] reductase -
  JMUB898_RS08235 (JMUB898_1658) fabD 1736686..1737612 (-) 927 WP_037541396.1 ACP S-malonyltransferase -
  JMUB898_RS08240 (JMUB898_1659) plsX 1737605..1738591 (-) 987 WP_037541395.1 phosphate acyltransferase PlsX -
  JMUB898_RS08245 (JMUB898_1660) fapR 1738584..1739153 (-) 570 WP_044466285.1 transcription factor FapR -
  JMUB898_RS08250 (JMUB898_1661) recG 1739376..1741424 (-) 2049 WP_002442500.1 ATP-dependent DNA helicase RecG -
  JMUB898_RS12785 - 1741647..1741916 (-) 270 WP_232019016.1 excalibur calcium-binding domain-containing protein -
  JMUB898_RS08255 (JMUB898_1662) - 1741896..1742501 (-) 606 Protein_1589 thermonuclease family protein -
  JMUB898_RS08260 (JMUB898_1663) - 1742779..1743846 (-) 1068 WP_037541391.1 Glu/Leu/Phe/Val dehydrogenase -
  JMUB898_RS08265 (JMUB898_1664) fakA 1744083..1745741 (-) 1659 WP_002442495.1 fatty acid kinase catalytic subunit FakA -
  JMUB898_RS08270 (JMUB898_1665) - 1745756..1746130 (-) 375 WP_037541388.1 Asp23/Gls24 family envelope stress response protein -
  JMUB898_RS08275 (JMUB898_1666) rpmB 1746509..1746697 (+) 189 WP_002435210.1 50S ribosomal protein L28 -
  JMUB898_RS08280 (JMUB898_1667) - 1746969..1747604 (-) 636 WP_002442491.1 thiamine diphosphokinase -
  JMUB898_RS08285 (JMUB898_1668) rpe 1747609..1748253 (-) 645 WP_002442490.1 ribulose-phosphate 3-epimerase -
  JMUB898_RS08290 (JMUB898_1669) rsgA 1748254..1749129 (-) 876 WP_002442489.1 ribosome small subunit-dependent GTPase A -
  JMUB898_RS08295 (JMUB898_1670) - 1749305..1750492 (+) 1188 WP_002442488.1 MFS transporter -

Sequence


Protein


Download         Length: 290 a.a.        Molecular weight: 33821.84 Da        Isoelectric Point: 8.8335

>NTDB_id=70215 JMUB898_RS08145 WP_037541402.1 1714958..1715830(-) (dprA) [Staphylococcus caprae strain JMUB898]
MIQHTLLKLYWANFTTTQVHQIIDFYPDFSLENEQTRMDIIKDWVLKQNSHALQRKLDQFKMLKTEYLYNYMKRIKLKYV
TYYDKDYPLLLKEIYHFPYVIFYKGTKQLFNQPHTLAVIGSRKSTSYTTQALEYLFPSFQQIQMTIISGLAYGADSVAHQ
VALKYHLPTIGVLGFGHDYHYPQSTYQLRDKIEKSGLVLSEYPPHSAISKYKFPERNRLISGLSRGLLITEAEEKSGSQI
TVDCALEQNRNVYVLPGSMFNQMTKGNLLRLEEGAQVVLDESSILTDYTF

Nucleotide


Download         Length: 873 bp        

>NTDB_id=70215 JMUB898_RS08145 WP_037541402.1 1714958..1715830(-) (dprA) [Staphylococcus caprae strain JMUB898]
TTGATTCAACACACTTTATTAAAACTTTATTGGGCTAATTTCACTACAACGCAAGTACATCAAATCATTGATTTCTATCC
TGACTTTTCCTTGGAAAATGAACAAACAAGAATGGATATTATAAAAGATTGGGTATTAAAACAAAATTCCCACGCATTGC
AAAGAAAACTTGATCAATTTAAAATGCTAAAAACTGAGTATTTATACAACTATATGAAACGTATAAAACTAAAATATGTG
ACTTACTATGACAAAGATTATCCTTTACTTCTCAAAGAAATCTATCATTTTCCATACGTAATTTTTTATAAAGGAACCAA
ACAATTGTTTAATCAACCTCATACATTAGCTGTAATCGGCTCTCGTAAATCTACTTCATATACGACACAAGCTTTAGAGT
ATCTTTTTCCTTCATTTCAACAAATTCAAATGACTATAATTTCTGGTTTAGCATACGGCGCAGATAGTGTAGCGCATCAA
GTCGCTCTCAAATACCATTTACCCACCATAGGAGTTCTGGGATTCGGTCATGATTATCACTATCCTCAATCCACATATCA
ATTAAGAGATAAGATTGAAAAAAGTGGATTAGTATTAAGTGAATATCCTCCTCATTCAGCAATCAGTAAGTATAAATTTC
CAGAAAGAAATAGATTGATAAGTGGGCTTTCACGTGGCTTACTTATTACGGAAGCTGAAGAAAAAAGTGGCAGTCAAATT
ACTGTTGATTGTGCTTTAGAACAAAATCGAAATGTGTATGTGTTACCTGGATCCATGTTTAATCAAATGACAAAGGGAAA
TTTACTTAGATTAGAAGAAGGTGCTCAAGTCGTATTAGATGAAAGCAGCATTTTAACAGACTATACATTCTAA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  dprA Staphylococcus aureus MW2

57.292

99.31

0.569

  dprA Staphylococcus aureus N315

57.292

99.31

0.569

  dprA Streptococcus mutans UA159

36.552

100

0.366


Multiple sequence alignment