Detailed information    

insolico Bioinformatically predicted

Overview

Name   comGG   Type   Machinery gene
Locus tag   NG745_RS12010 Genome accession   NZ_CP099465
Coordinates   2470098..2470475 (-) Length   125 a.a.
NCBI ID   WP_012117980.1    Uniprot ID   -
Organism   Bacillus velezensis strain Ag75     
Function   dsDNA binding to the cell surface; assembly of the pseudopilus (predicted from homology)   
DNA binding and uptake

Genomic Context

Location: 2465098..2475475
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG745_RS11970 (NG745_11970) - 2465596..2466390 (+) 795 WP_098081582.1 YqhG family protein -
  NG745_RS11975 (NG745_11975) sinI 2466567..2466740 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NG745_RS11980 (NG745_11980) sinR 2466774..2467109 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NG745_RS11985 (NG745_11985) tasA 2467157..2467942 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NG745_RS11990 (NG745_11990) sipW 2468007..2468591 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NG745_RS11995 (NG745_11995) tapA 2468563..2469234 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  NG745_RS12000 (NG745_12000) - 2469493..2469822 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NG745_RS12005 (NG745_12005) - 2469862..2470041 (-) 180 WP_003153093.1 YqzE family protein -
  NG745_RS12010 (NG745_12010) comGG 2470098..2470475 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  NG745_RS12015 (NG745_12015) comGF 2470476..2470976 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  NG745_RS12020 (NG745_12020) comGE 2470885..2471199 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  NG745_RS12025 (NG745_12025) comGD 2471183..2471620 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene
  NG745_RS12030 (NG745_12030) comGC 2471610..2471918 (-) 309 WP_003153087.1 competence type IV pilus major pilin ComGC Machinery gene
  NG745_RS12035 (NG745_12035) comGB 2471923..2472960 (-) 1038 WP_098081583.1 competence type IV pilus assembly protein ComGB Machinery gene
  NG745_RS12040 (NG745_12040) comGA 2472947..2474017 (-) 1071 WP_003153083.1 competence type IV pilus ATPase ComGA Machinery gene
  NG745_RS12045 (NG745_12045) - 2474210..2475160 (-) 951 WP_007408319.1 magnesium transporter CorA family protein -

Sequence

Protein


Download         Length: 125 a.a.        Molecular weight: 14195.14 Da        Isoelectric Point: 9.7165

>NTDB_id=699877 NG745_RS12010 WP_012117980.1 2470098..2470475(-) (comGG) [Bacillus velezensis strain Ag75]
MYKSDGFIYPAVLFVSAAVLLVISYTSSDFITRKTFAKEAGEYWIGENLLQNGVLLSSRHMTQGQKVQTGTQRFPYGTVS
FHITGSDRRETVQVTIQAETTTGTRREAHLLFDQKKKQLIQWTEV

Nucleotide


Download         Length: 378 bp        

>NTDB_id=699877 NG745_RS12010 WP_012117980.1 2470098..2470475(-) (comGG) [Bacillus velezensis strain Ag75]
ATGTACAAATCTGACGGTTTTATATATCCCGCGGTTCTGTTTGTTTCTGCCGCAGTTTTACTTGTCATCAGCTATACTTC
GTCTGATTTCATCACCCGAAAAACATTTGCAAAAGAGGCCGGGGAGTACTGGATCGGAGAGAATCTGCTCCAAAACGGCG
TGCTGCTGTCAAGCCGCCATATGACACAGGGACAAAAGGTCCAAACTGGTACACAGCGTTTTCCGTATGGCACCGTTTCT
TTTCACATCACGGGGAGTGATCGCCGGGAAACGGTTCAGGTTACAATTCAGGCGGAAACAACGACCGGAACGAGACGGGA
GGCTCACCTTTTGTTCGATCAGAAGAAGAAACAGCTGATTCAATGGACGGAAGTATAA

Domains

Predicted by InterproScan.

ComG operon protein 7 (ComGG)

(30-124)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  comGG Bacillus subtilis subsp. subtilis str. 168

51.613

99.2

0.512