Detailed information    

insolico Bioinformatically predicted

Overview

Name   sinI   Type   Regulator
Locus tag   NG745_RS11975 Genome accession   NZ_CP099465
Coordinates   2466567..2466740 (+) Length   57 a.a.
NCBI ID   WP_003153105.1    Uniprot ID   A7Z6M7
Organism   Bacillus velezensis strain Ag75     
Function   inhibit the expression of sinR (predicted from homology)   
Competence regulation

Genomic Context

Location: 2461567..2471740
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG745_RS11960 (NG745_11960) gcvT 2462380..2463480 (-) 1101 WP_015388009.1 glycine cleavage system aminomethyltransferase GcvT -
  NG745_RS11965 (NG745_11965) - 2463904..2465574 (+) 1671 WP_025284995.1 SNF2-related protein -
  NG745_RS11970 (NG745_11970) - 2465596..2466390 (+) 795 WP_098081582.1 YqhG family protein -
  NG745_RS11975 (NG745_11975) sinI 2466567..2466740 (+) 174 WP_003153105.1 anti-repressor SinI Regulator
  NG745_RS11980 (NG745_11980) sinR 2466774..2467109 (+) 336 WP_003153104.1 transcriptional regulator SinR Regulator
  NG745_RS11985 (NG745_11985) tasA 2467157..2467942 (-) 786 WP_007408329.1 biofilm matrix protein TasA -
  NG745_RS11990 (NG745_11990) sipW 2468007..2468591 (-) 585 WP_015240205.1 signal peptidase I SipW -
  NG745_RS11995 (NG745_11995) tapA 2468563..2469234 (-) 672 WP_063094776.1 amyloid fiber anchoring/assembly protein TapA -
  NG745_RS12000 (NG745_12000) - 2469493..2469822 (+) 330 WP_012117979.1 DUF3889 domain-containing protein -
  NG745_RS12005 (NG745_12005) - 2469862..2470041 (-) 180 WP_003153093.1 YqzE family protein -
  NG745_RS12010 (NG745_12010) comGG 2470098..2470475 (-) 378 WP_012117980.1 competence type IV pilus minor pilin ComGG Machinery gene
  NG745_RS12015 (NG745_12015) comGF 2470476..2470976 (-) 501 WP_254895460.1 competence type IV pilus minor pilin ComGF -
  NG745_RS12020 (NG745_12020) comGE 2470885..2471199 (-) 315 WP_080130386.1 competence type IV pilus minor pilin ComGE Machinery gene
  NG745_RS12025 (NG745_12025) comGD 2471183..2471620 (-) 438 WP_012117983.1 competence type IV pilus minor pilin ComGD Machinery gene

Sequence

Protein


Download         Length: 57 a.a.        Molecular weight: 6695.72 Da        Isoelectric Point: 9.8170

>NTDB_id=699875 NG745_RS11975 WP_003153105.1 2466567..2466740(+) (sinI) [Bacillus velezensis strain Ag75]
MKNAKMEFSQLDKEWVELILEAQKANISLEEIRKYLLSHKKSSQHIQAARSHTVNPF

Nucleotide


Download         Length: 174 bp        

>NTDB_id=699875 NG745_RS11975 WP_003153105.1 2466567..2466740(+) (sinI) [Bacillus velezensis strain Ag75]
ATGAAAAATGCAAAAATGGAATTTTCGCAATTAGATAAGGAATGGGTTGAGCTGATATTAGAAGCCCAAAAAGCAAATAT
CAGCCTAGAAGAAATACGCAAATACCTGCTTTCGCATAAAAAGTCTTCTCAACATATCCAGGCAGCCAGAAGTCATACCG
TAAATCCTTTCTGA

Domains

Predicted by InterproScan.

Anti-repressor SinI (SinI)

(11-37)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A7Z6M7

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  sinI Bacillus subtilis subsp. subtilis str. 168

70.175

100

0.702