Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NG694_RS05900 Genome accession   NZ_CP099457
Coordinates   1194897..1195379 (-) Length   160 a.a.
NCBI ID   WP_014601507.1    Uniprot ID   A0AAN2XYP2
Organism   Listeria monocytogenes strain L1812     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1160495..1210754 1194897..1195379 within 0


Gene organization within MGE regions


Location: 1160495..1210754
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG694_RS05725 (NG694_05725) - 1160495..1161397 (-) 903 WP_003723662.1 YitT family protein -
  NG694_RS05730 (NG694_05730) - 1161481..1161843 (-) 363 WP_009925066.1 YisL family protein -
  NG694_RS05735 (NG694_05735) - 1161864..1162712 (-) 849 WP_009930518.1 fumarylacetoacetate hydrolase family protein -
  NG694_RS05740 (NG694_05740) addA 1162713..1166420 (-) 3708 WP_010989936.1 helicase-exonuclease AddAB subunit AddA -
  NG694_RS05745 (NG694_05745) addB 1166422..1169895 (-) 3474 WP_010989937.1 helicase-exonuclease AddAB subunit AddB -
  NG694_RS05750 (NG694_05750) - 1170045..1170401 (-) 357 WP_003723667.1 IDEAL domain-containing protein -
  NG694_RS05755 (NG694_05755) - 1170532..1170726 (+) 195 Protein_1114 competence protein ComK -
  NG694_RS05760 (NG694_05760) - 1170996..1171397 (+) 402 WP_014601488.1 hypothetical protein -
  NG694_RS05765 (NG694_05765) - 1171399..1171830 (+) 432 WP_014601489.1 helix-turn-helix transcriptional regulator -
  NG694_RS05770 (NG694_05770) - 1171827..1172324 (+) 498 WP_306277956.1 AP2 domain-containing protein -
  NG694_RS05775 (NG694_05775) - 1172401..1172952 (-) 552 WP_010989943.1 hypothetical protein -
  NG694_RS05780 (NG694_05780) - 1173447..1174292 (-) 846 WP_119890699.1 DUF5776 domain-containing protein -
  NG694_RS05785 (NG694_05785) - 1174292..1174573 (-) 282 WP_003722522.1 holin -
  NG694_RS05790 (NG694_05790) - 1174586..1174951 (-) 366 WP_003722523.1 hypothetical protein -
  NG694_RS05795 (NG694_05795) - 1174990..1177155 (-) 2166 WP_306277957.1 phage tail spike protein -
  NG694_RS05800 (NG694_05800) - 1177168..1178736 (-) 1569 WP_072231556.1 phage tail family protein -
  NG694_RS05805 (NG694_05805) - 1178733..1183532 (-) 4800 WP_072231557.1 phage tail tape measure protein -
  NG694_RS05810 (NG694_05810) - 1183537..1183812 (-) 276 WP_014601496.1 Gp15 family bacteriophage protein -
  NG694_RS05815 (NG694_05815) - 1183845..1184276 (-) 432 WP_026750198.1 hypothetical protein -
  NG694_RS05820 (NG694_05820) - 1184332..1185021 (-) 690 WP_014601498.1 Ig-like domain-containing protein -
  NG694_RS05825 (NG694_05825) - 1185026..1185397 (-) 372 WP_003725064.1 hypothetical protein -
  NG694_RS05830 (NG694_05830) - 1185394..1185711 (-) 318 WP_069001375.1 HK97 gp10 family phage protein -
  NG694_RS05835 (NG694_05835) - 1185701..1186066 (-) 366 WP_069001376.1 hypothetical protein -
  NG694_RS05840 (NG694_05840) - 1186066..1186419 (-) 354 WP_070232026.1 hypothetical protein -
  NG694_RS05845 (NG694_05845) - 1186420..1186575 (-) 156 WP_165826615.1 hypothetical protein -
  NG694_RS05850 (NG694_05850) - 1186589..1187461 (-) 873 WP_033533849.1 hypothetical protein -
  NG694_RS05855 (NG694_05855) - 1187484..1188038 (-) 555 WP_003744996.1 hypothetical protein -
  NG694_RS05860 (NG694_05860) - 1188134..1189177 (-) 1044 WP_023552448.1 phage minor capsid protein -
  NG694_RS05865 (NG694_05865) - 1189182..1190741 (-) 1560 WP_023552450.1 hypothetical protein -
  NG694_RS05870 (NG694_05870) - 1190756..1192075 (-) 1320 WP_014930196.1 PBSX family phage terminase large subunit -
  NG694_RS05875 (NG694_05875) - 1192011..1192880 (-) 870 WP_014601504.1 terminase small subunit -
  NG694_RS05880 (NG694_05880) - 1193069..1193350 (-) 282 WP_231854893.1 hypothetical protein -
  NG694_RS05885 (NG694_05885) - 1193692..1194144 (-) 453 WP_096923711.1 ArpU family phage packaging/lysis transcriptional regulator -
  NG694_RS05890 (NG694_05890) - 1194209..1194706 (-) 498 WP_003733720.1 Holliday junction resolvase RecU -
  NG694_RS05895 (NG694_05895) - 1194696..1194878 (-) 183 WP_003733721.1 hypothetical protein -
  NG694_RS05900 (NG694_05900) ssbA 1194897..1195379 (-) 483 WP_014601507.1 single-stranded DNA-binding protein Machinery gene
  NG694_RS05905 (NG694_05905) - 1195448..1195606 (-) 159 WP_014601508.1 hypothetical protein -
  NG694_RS05910 (NG694_05910) - 1195607..1195816 (-) 210 WP_014601509.1 hypothetical protein -
  NG694_RS05915 (NG694_05915) - 1195813..1196214 (-) 402 WP_014601510.1 hypothetical protein -
  NG694_RS05920 (NG694_05920) - 1196273..1196833 (-) 561 WP_014601511.1 DUF1642 domain-containing protein -
  NG694_RS05925 (NG694_05925) - 1196830..1197294 (-) 465 WP_014601512.1 class I SAM-dependent methyltransferase -
  NG694_RS05930 (NG694_05930) - 1197359..1197967 (-) 609 WP_003731837.1 hypothetical protein -
  NG694_RS05935 (NG694_05935) - 1198095..1198688 (-) 594 WP_119732476.1 pentapeptide repeat-containing protein -
  NG694_RS05940 (NG694_05940) - 1198767..1198982 (-) 216 WP_003731843.1 hypothetical protein -
  NG694_RS05945 (NG694_05945) - 1198994..1199161 (-) 168 WP_014601514.1 hypothetical protein -
  NG694_RS05950 (NG694_05950) - 1199166..1199621 (-) 456 WP_014601515.1 class I SAM-dependent methyltransferase -
  NG694_RS05955 (NG694_05955) - 1199618..1200541 (-) 924 WP_031660000.1 DnaD domain-containing protein -
  NG694_RS05960 (NG694_05960) - 1200555..1201193 (-) 639 WP_009930473.1 ERF family protein -
  NG694_RS05965 (NG694_05965) - 1201198..1201674 (-) 477 WP_009930471.1 siphovirus Gp157 family protein -
  NG694_RS05970 (NG694_05970) - 1201671..1201865 (-) 195 WP_009930470.1 hypothetical protein -
  NG694_RS05975 - 1201960..1202088 (-) 129 WP_009930468.1 hypothetical protein -
  NG694_RS05980 (NG694_05975) - 1202167..1202355 (-) 189 WP_003769989.1 gp45 family putative tail fiber system protein -
  NG694_RS05985 (NG694_05980) - 1202463..1202678 (-) 216 WP_003769990.1 hypothetical protein -
  NG694_RS05990 (NG694_05985) - 1202675..1203208 (-) 534 WP_009930464.1 hypothetical protein -
  NG694_RS05995 (NG694_05990) - 1203329..1204102 (-) 774 WP_003747301.1 phage repressor protein/antirepressor Ant -
  NG694_RS06000 (NG694_05995) - 1204060..1204158 (-) 99 Protein_1163 hypothetical protein -
  NG694_RS06005 (NG694_06000) - 1204166..1204369 (+) 204 WP_003725092.1 KTSC domain-containing protein -
  NG694_RS06010 (NG694_06005) - 1204370..1204537 (-) 168 WP_003725093.1 hypothetical protein -
  NG694_RS06015 (NG694_06010) - 1204534..1204770 (-) 237 WP_031660002.1 hypothetical protein -
  NG694_RS06020 (NG694_06015) - 1204782..1204976 (-) 195 WP_003735007.1 hypothetical protein -
  NG694_RS06025 (NG694_06020) - 1205043..1205210 (+) 168 WP_015967158.1 hypothetical protein -
  NG694_RS06030 (NG694_06025) - 1205212..1205367 (-) 156 WP_003769998.1 hypothetical protein -
  NG694_RS06035 (NG694_06030) - 1205384..1205560 (-) 177 WP_003769999.1 hypothetical protein -
  NG694_RS06040 (NG694_06035) - 1205784..1206050 (-) 267 WP_003727743.1 hypothetical protein -
  NG694_RS06045 (NG694_06040) - 1206083..1206286 (-) 204 WP_009930459.1 helix-turn-helix domain-containing protein -
  NG694_RS06050 (NG694_06045) - 1206455..1206931 (+) 477 WP_031644569.1 helix-turn-helix transcriptional regulator -
  NG694_RS06055 (NG694_06050) - 1207087..1207254 (+) 168 WP_003733638.1 hypothetical protein -
  NG694_RS06060 (NG694_06055) - 1207544..1208266 (+) 723 WP_009930456.1 hypothetical protein -
  NG694_RS06065 (NG694_06060) - 1208289..1208894 (+) 606 WP_003733641.1 hypothetical protein -
  NG694_RS06070 (NG694_06065) - 1208907..1209329 (+) 423 WP_003749252.1 hypothetical protein -
  NG694_RS06075 (NG694_06070) - 1209396..1210754 (+) 1359 WP_003733644.1 recombinase family protein -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17649.45 Da        Isoelectric Point: 4.9821

>NTDB_id=699728 NG694_RS05900 WP_014601507.1 1194897..1195379(-) (ssbA) [Listeria monocytogenes strain L1812]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLTGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEANYSNNNKNGSYRASSSQNSDSFANEGKPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=699728 NG694_RS05900 WP_014601507.1 1194897..1195379(-) (ssbA) [Listeria monocytogenes strain L1812]
ATGATGAATCGTGTCGTGCTCGTAGGACGTTTAACTAAAGATCCAGAGCTAAGATATACGCCAGCGGGTGTAGCAGTTGC
GACTTTTACACTTGCTGTCAATCGACCTTTTAAAAACGGGCAAGGAGAACAAGAAGCTGATTTTATTCAATGTGTTGTTT
GGCGTAAACCAGCAGAAAACGTCGCTAATTTCTTAAAAAAAGGAAGTTTAACAGGCGTTGATGGTCGCGTTCAAACTCGT
AACTATGAGGGGAACGACGGTAAGCGCGTTTATGTGACGGAAATAGTGGCCGAGAGTGTTCAATTTTTGGAACCTAAGCA
GAACGCTGTAGAAGGCTCTACACCGAATAATAATCAAAACGAAGCTAATTATTCAAATAACAATAAAAACGGCTCATATC
GAGCTAGTTCGAGCCAGAATAGTGATTCATTTGCAAACGAAGGTAAGCCGATTGATATTTCAGATGACGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

63.953

100

0.687
  ssb Latilactobacillus sakei subsp. sakei 23K

54.706

100

0.581
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

66.25

0.419