Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NG693_RS05645 Genome accession   NZ_CP099456
Coordinates   1144790..1145272 (-) Length   160 a.a.
NCBI ID   WP_014601507.1    Uniprot ID   A0AAN2XYP2
Organism   Listeria monocytogenes strain L1436     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1110262..1160548 1144790..1145272 within 0


Gene organization within MGE regions


Location: 1110262..1160548
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG693_RS05470 (NG693_05470) - 1110262..1111164 (-) 903 WP_003723662.1 YitT family protein -
  NG693_RS05475 (NG693_05475) - 1111248..1111610 (-) 363 WP_009925066.1 YisL family protein -
  NG693_RS05480 (NG693_05480) - 1111631..1112479 (-) 849 WP_009930518.1 fumarylacetoacetate hydrolase family protein -
  NG693_RS05485 (NG693_05485) addA 1112480..1116187 (-) 3708 WP_010989936.1 helicase-exonuclease AddAB subunit AddA -
  NG693_RS05490 (NG693_05490) addB 1116189..1119662 (-) 3474 WP_010989937.1 helicase-exonuclease AddAB subunit AddB -
  NG693_RS05495 (NG693_05495) - 1119812..1120168 (-) 357 WP_003723667.1 IDEAL domain-containing protein -
  NG693_RS05500 (NG693_05500) - 1120299..1120493 (+) 195 Protein_1063 competence protein ComK -
  NG693_RS05505 (NG693_05505) - 1120763..1121164 (+) 402 WP_014601488.1 hypothetical protein -
  NG693_RS05510 (NG693_05510) - 1121166..1121597 (+) 432 WP_014601489.1 helix-turn-helix transcriptional regulator -
  NG693_RS05515 (NG693_05515) - 1121594..1122094 (+) 501 WP_014601490.1 AP2 domain-containing protein -
  NG693_RS05520 (NG693_05520) - 1122300..1123298 (-) 999 WP_039153008.1 DUF3644 domain-containing protein -
  NG693_RS05525 (NG693_05525) - 1123401..1124246 (-) 846 WP_014930186.1 DUF5776 domain-containing protein -
  NG693_RS05530 (NG693_05530) - 1124246..1124512 (-) 267 WP_003733521.1 phage holin -
  NG693_RS05535 (NG693_05535) - 1124512..1124814 (-) 303 WP_014930187.1 hypothetical protein -
  NG693_RS05540 (NG693_05540) - 1124865..1127030 (-) 2166 WP_014601493.1 phage tail spike protein -
  NG693_RS05545 (NG693_05545) - 1127043..1128611 (-) 1569 WP_026747248.1 phage tail family protein -
  NG693_RS05550 (NG693_05550) - 1128608..1133407 (-) 4800 WP_046421573.1 phage tail tape measure protein -
  NG693_RS05555 (NG693_05555) - 1133412..1133702 (-) 291 WP_039380722.1 Gp15 family bacteriophage protein -
  NG693_RS05560 (NG693_05560) - 1133720..1134151 (-) 432 WP_003725062.1 hypothetical protein -
  NG693_RS05565 (NG693_05565) - 1134207..1134893 (-) 687 WP_014930190.1 Ig-like domain-containing protein -
  NG693_RS05570 (NG693_05570) - 1134898..1135269 (-) 372 WP_003745007.1 hypothetical protein -
  NG693_RS05575 (NG693_05575) - 1135266..1135583 (-) 318 WP_046421581.1 HK97 gp10 family phage protein -
  NG693_RS05580 (NG693_05580) - 1135573..1135938 (-) 366 WP_046421583.1 hypothetical protein -
  NG693_RS05585 (NG693_05585) - 1135938..1136291 (-) 354 WP_003745003.1 hypothetical protein -
  NG693_RS05590 (NG693_05590) - 1136292..1136471 (-) 180 WP_014930193.1 hypothetical protein -
  NG693_RS05595 (NG693_05595) - 1136485..1137357 (-) 873 WP_014930194.1 hypothetical protein -
  NG693_RS05600 (NG693_05600) - 1137380..1137934 (-) 555 WP_306277936.1 hypothetical protein -
  NG693_RS05605 (NG693_05605) - 1138030..1139073 (-) 1044 WP_014930195.1 phage minor capsid protein -
  NG693_RS05610 (NG693_05610) - 1139078..1140634 (-) 1557 WP_014601502.1 hypothetical protein -
  NG693_RS05615 (NG693_05615) - 1140649..1141968 (-) 1320 WP_014930196.1 PBSX family phage terminase large subunit -
  NG693_RS05620 (NG693_05620) - 1141904..1142773 (-) 870 WP_014601504.1 terminase small subunit -
  NG693_RS05625 (NG693_05625) - 1142962..1143243 (-) 282 WP_231854893.1 hypothetical protein -
  NG693_RS05630 (NG693_05630) - 1143585..1144037 (-) 453 WP_014601506.1 ArpU family phage packaging/lysis transcriptional regulator -
  NG693_RS05635 (NG693_05635) - 1144102..1144599 (-) 498 WP_003733720.1 Holliday junction resolvase RecU -
  NG693_RS05640 (NG693_05640) - 1144589..1144771 (-) 183 WP_003733721.1 hypothetical protein -
  NG693_RS05645 (NG693_05645) ssbA 1144790..1145272 (-) 483 WP_014601507.1 single-stranded DNA-binding protein Machinery gene
  NG693_RS05650 (NG693_05650) - 1145341..1145499 (-) 159 WP_014601508.1 hypothetical protein -
  NG693_RS05655 (NG693_05655) - 1145500..1145709 (-) 210 WP_014601509.1 hypothetical protein -
  NG693_RS05660 (NG693_05660) - 1145706..1146107 (-) 402 WP_014601510.1 hypothetical protein -
  NG693_RS05665 (NG693_05665) - 1146166..1146726 (-) 561 WP_014601511.1 DUF1642 domain-containing protein -
  NG693_RS05670 (NG693_05670) - 1146731..1147186 (-) 456 WP_077918689.1 class I SAM-dependent methyltransferase -
  NG693_RS05675 (NG693_05675) - 1147183..1148106 (-) 924 WP_046421613.1 DnaD domain-containing protein -
  NG693_RS05680 (NG693_05680) - 1148120..1148758 (-) 639 WP_009930473.1 ERF family protein -
  NG693_RS05685 (NG693_05685) - 1148763..1149239 (-) 477 WP_009930471.1 siphovirus Gp157 family protein -
  NG693_RS05690 (NG693_05690) - 1149236..1149430 (-) 195 WP_009930470.1 hypothetical protein -
  NG693_RS05695 - 1149525..1149653 (-) 129 WP_009930468.1 hypothetical protein -
  NG693_RS05700 (NG693_05695) - 1149732..1149920 (-) 189 WP_003769989.1 gp45 family putative tail fiber system protein -
  NG693_RS05705 (NG693_05700) - 1150028..1150243 (-) 216 WP_003769990.1 hypothetical protein -
  NG693_RS05710 (NG693_05705) - 1150240..1150773 (-) 534 WP_009930464.1 hypothetical protein -
  NG693_RS05715 (NG693_05710) - 1150894..1151667 (-) 774 WP_003747301.1 phage repressor protein/antirepressor Ant -
  NG693_RS05720 (NG693_05715) - 1151625..1151723 (-) 99 Protein_1107 hypothetical protein -
  NG693_RS05725 (NG693_05720) - 1151731..1151934 (+) 204 WP_003725092.1 KTSC domain-containing protein -
  NG693_RS05730 (NG693_05725) - 1151935..1152102 (-) 168 WP_003725093.1 hypothetical protein -
  NG693_RS05735 (NG693_05730) - 1152099..1152335 (-) 237 WP_031660002.1 hypothetical protein -
  NG693_RS05740 (NG693_05735) - 1152347..1152541 (-) 195 WP_003727745.1 hypothetical protein -
  NG693_RS05745 (NG693_05740) - 1152608..1152775 (+) 168 WP_015967158.1 hypothetical protein -
  NG693_RS05750 (NG693_05745) - 1152777..1152932 (-) 156 WP_003769998.1 hypothetical protein -
  NG693_RS05755 (NG693_05750) - 1152949..1153125 (-) 177 WP_003769999.1 hypothetical protein -
  NG693_RS05760 (NG693_05755) - 1153190..1153447 (+) 258 WP_046421625.1 hypothetical protein -
  NG693_RS05765 (NG693_05760) - 1153444..1153665 (-) 222 WP_046421627.1 hypothetical protein -
  NG693_RS05770 (NG693_05765) - 1153669..1153902 (-) 234 WP_046421628.1 helix-turn-helix transcriptional regulator -
  NG693_RS05775 (NG693_05770) - 1154058..1154480 (+) 423 WP_031641587.1 helix-turn-helix transcriptional regulator -
  NG693_RS05780 (NG693_05775) - 1154496..1154921 (+) 426 WP_046421633.1 ImmA/IrrE family metallo-endopeptidase -
  NG693_RS05785 (NG693_05780) - 1154937..1155542 (+) 606 WP_003733641.1 hypothetical protein -
  NG693_RS05790 (NG693_05785) - 1155555..1155977 (+) 423 WP_003749252.1 hypothetical protein -
  NG693_RS05795 (NG693_05790) - 1156016..1156963 (+) 948 WP_046421637.1 hypothetical protein -
  NG693_RS05800 (NG693_05795) - 1157357..1158244 (+) 888 WP_003733643.1 hypothetical protein -
  NG693_RS05805 (NG693_05800) - 1158321..1159679 (+) 1359 WP_003733644.1 recombinase family protein -
  NG693_RS05810 (NG693_05805) - 1159670..1160146 (+) 477 WP_009930453.1 competence protein ComK -
  NG693_RS05815 (NG693_05810) - 1160201..1160548 (-) 348 WP_003739618.1 helix-turn-helix transcriptional regulator -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17649.45 Da        Isoelectric Point: 4.9821

>NTDB_id=699688 NG693_RS05645 WP_014601507.1 1144790..1145272(-) (ssbA) [Listeria monocytogenes strain L1436]
MMNRVVLVGRLTKDPELRYTPAGVAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLTGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPKQNAVEGSTPNNNQNEANYSNNNKNGSYRASSSQNSDSFANEGKPIDISDDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=699688 NG693_RS05645 WP_014601507.1 1144790..1145272(-) (ssbA) [Listeria monocytogenes strain L1436]
ATGATGAATCGTGTCGTGCTCGTAGGACGTTTAACTAAAGATCCAGAGCTAAGATATACGCCAGCGGGTGTAGCAGTTGC
GACTTTTACACTTGCTGTCAATCGACCTTTTAAAAACGGGCAAGGAGAACAAGAAGCTGATTTTATTCAATGTGTTGTTT
GGCGTAAACCAGCAGAAAACGTCGCTAATTTCTTAAAAAAAGGAAGTTTAACAGGCGTTGATGGTCGCGTTCAAACTCGT
AACTATGAGGGGAACGACGGTAAGCGCGTTTATGTGACGGAAATAGTGGCCGAGAGTGTTCAATTTTTGGAACCTAAGCA
GAACGCTGTAGAAGGCTCTACACCGAATAATAATCAAAACGAAGCTAATTATTCAAATAACAATAAAAACGGCTCATATC
GAGCTAGTTCGAGCCAGAATAGTGATTCATTTGCAAACGAAGGTAAGCCGATTGATATTTCAGATGACGATTTGCCATTT
TGA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

63.953

100

0.687
  ssb Latilactobacillus sakei subsp. sakei 23K

54.706

100

0.581
  ssbB Bacillus subtilis subsp. subtilis str. 168

63.208

66.25

0.419