Detailed information    

insolico Bioinformatically predicted

Overview

Name   ssbA   Type   Machinery gene
Locus tag   NG692_RS05615 Genome accession   NZ_CP099454
Coordinates   1138986..1139468 (-) Length   160 a.a.
NCBI ID   WP_025370642.1    Uniprot ID   A0A5L2LNB1
Organism   Listeria monocytogenes strain L1551     
Function   ssDNA binding (predicted from homology)   
DNA processing

Related MGE

Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 1104767..1155138 1138986..1139468 within 0


Gene organization within MGE regions


Location: 1104767..1155138
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NG692_RS05440 (NG692_05440) - 1104767..1105669 (-) 903 WP_003723662.1 YitT family protein -
  NG692_RS05445 (NG692_05445) - 1105753..1106115 (-) 363 WP_009925066.1 YisL family protein -
  NG692_RS05450 (NG692_05450) - 1106136..1106984 (-) 849 WP_009930518.1 fumarylacetoacetate hydrolase family protein -
  NG692_RS05455 (NG692_05455) addA 1106985..1110692 (-) 3708 WP_010989936.1 helicase-exonuclease AddAB subunit AddA -
  NG692_RS05460 (NG692_05460) addB 1110694..1114167 (-) 3474 WP_010989937.1 helicase-exonuclease AddAB subunit AddB -
  NG692_RS05465 (NG692_05465) - 1114317..1114673 (-) 357 WP_003723667.1 IDEAL domain-containing protein -
  NG692_RS05470 (NG692_05470) - 1114804..1114998 (+) 195 Protein_1057 competence protein ComK -
  NG692_RS05475 (NG692_05475) - 1115268..1115669 (+) 402 WP_014601488.1 hypothetical protein -
  NG692_RS05480 (NG692_05480) - 1115671..1116102 (+) 432 WP_014601489.1 helix-turn-helix transcriptional regulator -
  NG692_RS05485 (NG692_05485) - 1116099..1116599 (+) 501 WP_014601490.1 AP2 domain-containing protein -
  NG692_RS05490 (NG692_05490) - 1116805..1117803 (-) 999 WP_012951560.1 DUF3644 domain-containing protein -
  NG692_RS05495 (NG692_05495) - 1117906..1118751 (-) 846 WP_070232005.1 DUF5776 domain-containing protein -
  NG692_RS05500 (NG692_05500) - 1118751..1119032 (-) 282 WP_003722522.1 holin -
  NG692_RS05505 (NG692_05505) - 1119045..1119410 (-) 366 WP_003722523.1 hypothetical protein -
  NG692_RS05510 (NG692_05510) - 1119449..1121611 (-) 2163 WP_070232023.1 phage tail spike protein -
  NG692_RS05515 (NG692_05515) - 1121624..1123192 (-) 1569 WP_070232024.1 phage tail family protein -
  NG692_RS05520 (NG692_05520) - 1123189..1127988 (-) 4800 WP_070232025.1 phage tail tape measure protein -
  NG692_RS05525 (NG692_05525) - 1127993..1128268 (-) 276 WP_014601496.1 Gp15 family bacteriophage protein -
  NG692_RS05530 (NG692_05530) - 1128301..1128732 (-) 432 WP_026750198.1 hypothetical protein -
  NG692_RS05535 (NG692_05535) - 1128788..1129477 (-) 690 WP_014601498.1 Ig-like domain-containing protein -
  NG692_RS05540 (NG692_05540) - 1129482..1129853 (-) 372 WP_003725064.1 hypothetical protein -
  NG692_RS05545 (NG692_05545) - 1129850..1130167 (-) 318 WP_069001375.1 HK97 gp10 family phage protein -
  NG692_RS05550 (NG692_05550) - 1130157..1130522 (-) 366 WP_069001376.1 hypothetical protein -
  NG692_RS05555 (NG692_05555) - 1130522..1130875 (-) 354 WP_070232026.1 hypothetical protein -
  NG692_RS05560 (NG692_05560) - 1130876..1131031 (-) 156 WP_165826615.1 hypothetical protein -
  NG692_RS05565 (NG692_05565) - 1131045..1131917 (-) 873 WP_033533849.1 hypothetical protein -
  NG692_RS05570 (NG692_05570) - 1131940..1132494 (-) 555 WP_070232027.1 hypothetical protein -
  NG692_RS05575 (NG692_05575) - 1132590..1133633 (-) 1044 WP_070232028.1 phage minor capsid protein -
  NG692_RS05580 (NG692_05580) - 1133638..1135197 (-) 1560 WP_023552450.1 hypothetical protein -
  NG692_RS05585 (NG692_05585) - 1135212..1136531 (-) 1320 WP_025370639.1 PBSX family phage terminase large subunit -
  NG692_RS05590 (NG692_05590) terS 1136524..1137249 (-) 726 WP_003733717.1 phage terminase small subunit -
  NG692_RS05595 (NG692_05595) - 1137293..1137520 (-) 228 WP_003733718.1 hypothetical protein -
  NG692_RS05600 (NG692_05600) - 1137796..1138230 (-) 435 WP_025370640.1 ArpU family phage packaging/lysis transcriptional regulator -
  NG692_RS05605 (NG692_05605) - 1138295..1138765 (-) 471 WP_223196595.1 Holliday junction resolvase RecU -
  NG692_RS05610 (NG692_05610) - 1138782..1138964 (-) 183 WP_025370641.1 hypothetical protein -
  NG692_RS05615 (NG692_05615) ssbA 1138986..1139468 (-) 483 WP_025370642.1 single-stranded DNA-binding protein Machinery gene
  NG692_RS05620 (NG692_05620) - 1139469..1139723 (-) 255 WP_003733723.1 hypothetical protein -
  NG692_RS05625 (NG692_05625) - 1139902..1140438 (-) 537 WP_009930870.1 hypothetical protein -
  NG692_RS05630 (NG692_05630) - 1140435..1140602 (-) 168 WP_009930868.1 hypothetical protein -
  NG692_RS05635 (NG692_05635) - 1140603..1140812 (-) 210 WP_014601509.1 hypothetical protein -
  NG692_RS05640 (NG692_05640) - 1140809..1141210 (-) 402 WP_014601510.1 hypothetical protein -
  NG692_RS05645 (NG692_05645) - 1141288..1141434 (-) 147 WP_014929526.1 hypothetical protein -
  NG692_RS05650 (NG692_05650) - 1141431..1141991 (-) 561 WP_014601511.1 DUF1642 domain-containing protein -
  NG692_RS05655 (NG692_05655) - 1141988..1142452 (-) 465 WP_014601512.1 class I SAM-dependent methyltransferase -
  NG692_RS05660 (NG692_05660) - 1142495..1142983 (-) 489 WP_014601513.1 pentapeptide repeat-containing protein -
  NG692_RS05665 (NG692_05665) - 1143062..1143277 (-) 216 WP_003731843.1 hypothetical protein -
  NG692_RS05670 (NG692_05670) - 1143289..1143456 (-) 168 WP_014601514.1 hypothetical protein -
  NG692_RS05675 (NG692_05675) - 1143461..1143916 (-) 456 WP_014601515.1 class I SAM-dependent methyltransferase -
  NG692_RS05680 (NG692_05680) - 1143913..1144836 (-) 924 WP_031660000.1 DnaD domain-containing protein -
  NG692_RS05685 (NG692_05685) - 1144850..1145488 (-) 639 WP_009930473.1 ERF family protein -
  NG692_RS05690 (NG692_05690) - 1145493..1145969 (-) 477 WP_009930471.1 siphovirus Gp157 family protein -
  NG692_RS05695 (NG692_05695) - 1145966..1146160 (-) 195 WP_009930470.1 hypothetical protein -
  NG692_RS05700 - 1146255..1146383 (-) 129 WP_009930468.1 hypothetical protein -
  NG692_RS05705 (NG692_05700) - 1146462..1146650 (-) 189 WP_003769989.1 gp45 family putative tail fiber system protein -
  NG692_RS05710 (NG692_05705) - 1146758..1146973 (-) 216 WP_003769990.1 hypothetical protein -
  NG692_RS05715 (NG692_05710) - 1146970..1147503 (-) 534 WP_009930464.1 hypothetical protein -
  NG692_RS05720 (NG692_05715) - 1147628..1148407 (-) 780 WP_003769993.1 phage antirepressor Ant -
  NG692_RS05725 (NG692_05720) - 1148389..1148463 (-) 75 Protein_1108 hypothetical protein -
  NG692_RS05730 (NG692_05725) - 1148471..1148713 (+) 243 WP_025370647.1 hypothetical protein -
  NG692_RS05735 (NG692_05730) - 1148706..1148867 (-) 162 WP_003727748.1 hypothetical protein -
  NG692_RS05740 (NG692_05735) - 1148899..1149180 (-) 282 WP_003769995.1 hypothetical protein -
  NG692_RS05745 (NG692_05740) - 1149177..1149413 (-) 237 WP_003733634.1 hypothetical protein -
  NG692_RS05750 (NG692_05745) - 1149480..1149647 (+) 168 WP_015967158.1 hypothetical protein -
  NG692_RS05755 (NG692_05750) - 1149649..1149804 (-) 156 WP_003769998.1 hypothetical protein -
  NG692_RS05760 (NG692_05755) - 1149821..1149997 (-) 177 WP_003769999.1 hypothetical protein -
  NG692_RS05765 (NG692_05760) - 1150062..1150325 (+) 264 WP_077948110.1 hypothetical protein -
  NG692_RS05770 (NG692_05765) - 1150285..1150470 (-) 186 WP_003770002.1 hypothetical protein -
  NG692_RS05775 (NG692_05770) - 1150474..1150716 (-) 243 WP_033837816.1 helix-turn-helix transcriptional regulator -
  NG692_RS05780 (NG692_05775) - 1150842..1151147 (+) 306 WP_003727741.1 helix-turn-helix transcriptional regulator -
  NG692_RS05785 (NG692_05780) - 1151180..1151671 (+) 492 WP_003770011.1 hypothetical protein -
  NG692_RS05790 (NG692_05785) - 1151928..1152650 (+) 723 WP_009930456.1 hypothetical protein -
  NG692_RS05795 (NG692_05790) - 1152673..1153278 (+) 606 WP_003733641.1 hypothetical protein -
  NG692_RS05800 (NG692_05795) - 1153291..1153713 (+) 423 WP_003749252.1 hypothetical protein -
  NG692_RS05805 (NG692_05800) - 1153780..1155138 (+) 1359 WP_061104696.1 recombinase family protein -

Sequence

Protein


Download         Length: 160 a.a.        Molecular weight: 17654.55 Da        Isoelectric Point: 6.9828

>NTDB_id=699648 NG692_RS05615 WP_025370642.1 1138986..1139468(-) (ssbA) [Listeria monocytogenes strain L1551]
MMNRVILVGRLTKDPDLRYTPAGAAVATFTLAVNRPFKNGQGEQEADFIQCVVWRKPAENVANFLKKGSLTGVDGRVQTR
NYEGNDGKRVYVTEIVAESVQFLEPKHNLAEGSTSNNNQNGANYSNNSKTTPYRADSSQNKDSFANEGKPIDINPDDLPF

Nucleotide


Download         Length: 483 bp        

>NTDB_id=699648 NG692_RS05615 WP_025370642.1 1138986..1139468(-) (ssbA) [Listeria monocytogenes strain L1551]
ATGATGAATCGTGTCATACTAGTAGGACGCTTAACTAAAGACCCTGATTTACGTTATACCCCAGCTGGTGCAGCAGTTGC
GACTTTTACATTAGCTGTCAATCGCCCTTTCAAAAACGGGCAAGGAGAGCAAGAAGCTGACTTTATTCAATGTGTAGTTT
GGCGTAAACCAGCAGAAAACGTTGCTAATTTCTTGAAAAAAGGAAGTTTAACAGGCGTTGATGGTCGAGTTCAAACTCGT
AATTACGAGGGAAACGACGGTAAGCGCGTTTATGTGACGGAAATCGTAGCTGAATCAGTTCAATTTTTAGAGCCTAAGCA
CAACCTCGCAGAAGGCTCTACATCGAATAATAATCAGAACGGGGCTAATTATTCAAATAATAGTAAAACAACTCCATATC
GAGCTGATTCGAGTCAGAATAAGGATTCATTTGCAAATGAGGGTAAGCCGATAGACATTAACCCGGATGACTTGCCATTT
TAA

Domains

Predicted by InterproScan.

Single-strand binding protein family (SSB)

(2-103)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A0A5L2LNB1

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  ssbA Bacillus subtilis subsp. subtilis str. 168

61.364

100

0.675
  ssb Latilactobacillus sakei subsp. sakei 23K

55.294

100

0.587
  ssbB Bacillus subtilis subsp. subtilis str. 168

65.094

66.25

0.431