Detailed information
Overview
| Name | pilL | Type | Machinery gene |
| Locus tag | NC846_RS02355 | Genome accession | NZ_CP098458 |
| Coordinates | 453796..454269 (+) | Length | 157 a.a. |
| NCBI ID | WP_172760650.1 | Uniprot ID | - |
| Organism | Neisseria gonorrhoeae strain 10588 | ||
| Function | type IV pilus (predicted from homology) DNA binding and uptake |
||
Related MGE
Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.
Gene-MGE association summary
| MGE type | MGE coordinates | Gene coordinates | Relative position | Distance (bp) |
|---|---|---|---|---|
| Prophage | 444114..492803 | 453796..454269 | within | 0 |
Gene organization within MGE regions
Location: 444114..492803
| Locus tag | Gene name | Coordinates (strand) | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NC846_RS02300 (NC846_02285) | - | 444114..445190 (-) | 1077 | WP_003692814.1 | sulfate/molybdate ABC transporter ATP-binding protein | - |
| NC846_RS02305 (NC846_02290) | cysW | 445187..446047 (-) | 861 | WP_003699617.1 | sulfate ABC transporter permease subunit CysW | - |
| NC846_RS02310 (NC846_02295) | cysT | 446236..447063 (-) | 828 | WP_003699619.1 | sulfate ABC transporter permease subunit CysT | - |
| NC846_RS02315 (NC846_02300) | - | 447244..447576 (+) | 333 | WP_003687908.1 | hypothetical protein | - |
| NC846_RS02320 (NC846_02305) | - | 447903..448412 (+) | 510 | WP_003687909.1 | isoprenylcysteine carboxyl methyltransferase family protein | - |
| NC846_RS02325 (NC846_02310) | - | 448644..449225 (-) | 582 | WP_003690895.1 | superoxide dismutase | - |
| NC846_RS02330 (NC846_02315) | dnaB | 449389..450795 (+) | 1407 | WP_003699622.1 | replicative DNA helicase | - |
| NC846_RS02335 (NC846_02320) | pilH | 450949..451614 (+) | 666 | WP_003699624.1 | Tfp pilus assembly protein FimT/FimU | Machinery gene |
| NC846_RS02340 (NC846_02325) | pilV | 451646..452257 (+) | 612 | WP_003699626.1 | type IV pilus modification protein PilV | Machinery gene |
| NC846_RS02345 (NC846_02330) | pilJ | 452254..453204 (+) | 951 | WP_263852724.1 | PilW family protein | Machinery gene |
| NC846_RS02350 (NC846_02335) | pilK | 453183..453794 (+) | 612 | WP_033911077.1 | PilX N-terminal domain-containing pilus assembly protein | Machinery gene |
| NC846_RS02355 (NC846_02340) | pilL | 453796..454269 (+) | 474 | WP_172760650.1 | PilX family type IV pilin | Machinery gene |
| NC846_RS02360 (NC846_02345) | - | 454339..454647 (-) | 309 | WP_025456177.1 | AzlD family protein | - |
| NC846_RS02365 (NC846_02350) | - | 454644..455354 (-) | 711 | Protein_464 | AzlC family ABC transporter permease | - |
| NC846_RS02370 (NC846_02355) | dut | 455520..455972 (+) | 453 | WP_003699637.1 | dUTP diphosphatase | - |
| NC846_RS02375 (NC846_02360) | dapC | 456048..457235 (+) | 1188 | WP_003699639.1 | succinyldiaminopimelate transaminase | - |
| NC846_RS02380 (NC846_02365) | yaaA | 457391..458170 (+) | 780 | WP_003699641.1 | peroxide stress protein YaaA | - |
| NC846_RS02395 (NC846_02380) | - | 458700..459893 (+) | 1194 | WP_017146746.1 | phage integrase central domain-containing protein | - |
| NC846_RS02400 (NC846_02385) | - | 460249..460518 (-) | 270 | WP_003687928.1 | hypothetical protein | - |
| NC846_RS02405 (NC846_02390) | - | 460713..461396 (-) | 684 | WP_003687929.1 | DUF2786 domain-containing protein | - |
| NC846_RS11775 | - | 461677..461943 (-) | 267 | Protein_471 | hypothetical protein | - |
| NC846_RS02415 (NC846_02400) | - | 462054..462269 (-) | 216 | WP_003691538.1 | hypothetical protein | - |
| NC846_RS02420 (NC846_02405) | - | 462321..462812 (-) | 492 | WP_033911206.1 | siphovirus Gp157 family protein | - |
| NC846_RS02425 (NC846_02410) | - | 462809..462991 (-) | 183 | WP_003691535.1 | hypothetical protein | - |
| NC846_RS02430 (NC846_02415) | - | 463131..463817 (-) | 687 | WP_010357532.1 | phage replication initiation protein, NGO0469 family | - |
| NC846_RS02435 (NC846_02420) | - | 463886..464047 (-) | 162 | WP_003693867.1 | hypothetical protein | - |
| NC846_RS02440 (NC846_02425) | - | 464044..464322 (-) | 279 | WP_229930232.1 | NGO1622 family putative holin | - |
| NC846_RS02445 (NC846_02430) | - | 464475..464807 (-) | 333 | WP_003695500.1 | hypothetical protein | - |
| NC846_RS02450 (NC846_02435) | - | 464949..465242 (-) | 294 | WP_263852713.1 | hypothetical protein | - |
| NC846_RS02455 (NC846_02440) | - | 465239..465715 (-) | 477 | WP_002255718.1 | DUF6948 domain-containing protein | - |
| NC846_RS02460 (NC846_02445) | - | 465748..465948 (-) | 201 | WP_003692842.1 | hypothetical protein | - |
| NC846_RS02465 (NC846_02450) | - | 466432..466650 (+) | 219 | WP_003691731.1 | hypothetical protein | - |
| NC846_RS02470 (NC846_02455) | - | 466667..467026 (-) | 360 | WP_003691733.1 | hypothetical protein | - |
| NC846_RS02475 (NC846_02460) | - | 467027..467566 (-) | 540 | WP_003695998.1 | Panacea domain-containing protein | - |
| NC846_RS02480 (NC846_02465) | - | 467726..468442 (-) | 717 | WP_003695999.1 | helix-turn-helix transcriptional regulator | - |
| NC846_RS02485 (NC846_02470) | - | 468823..469050 (+) | 228 | WP_003698261.1 | helix-turn-helix domain-containing protein | - |
| NC846_RS02490 (NC846_02475) | - | 469168..470232 (+) | 1065 | WP_003689134.1 | hypothetical protein | - |
| NC846_RS02495 (NC846_02480) | - | 470229..471590 (+) | 1362 | WP_003689132.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NC846_RS02500 (NC846_02485) | - | 471607..471837 (+) | 231 | WP_012503490.1 | hypothetical protein | - |
| NC846_RS02505 (NC846_02490) | - | 471929..472423 (+) | 495 | WP_003691434.1 | DUF3310 domain-containing protein | - |
| NC846_RS02510 (NC846_02495) | - | 472806..472955 (+) | 150 | WP_033911194.1 | phage associated protein | - |
| NC846_RS02515 (NC846_02500) | - | 472983..473264 (+) | 282 | WP_003689109.1 | hypothetical protein | - |
| NC846_RS02520 (NC846_02505) | - | 473255..473692 (+) | 438 | WP_215217859.1 | RusA family crossover junction endodeoxyribonuclease | - |
| NC846_RS02525 (NC846_02510) | - | 473685..473990 (+) | 306 | WP_025456182.1 | DUF1364 domain-containing protein | - |
| NC846_RS02530 (NC846_02515) | - | 473987..474370 (+) | 384 | WP_003699764.1 | recombination protein NinB | - |
| NC846_RS02535 (NC846_02520) | - | 474361..474879 (+) | 519 | WP_003693459.1 | HNH endonuclease | - |
| NC846_RS02540 (NC846_02525) | - | 474944..475366 (+) | 423 | WP_003690919.1 | hypothetical protein | - |
| NC846_RS02545 (NC846_02530) | - | 475366..475905 (+) | 540 | WP_003693457.1 | hypothetical protein | - |
| NC846_RS02550 (NC846_02535) | - | 475886..477160 (+) | 1275 | WP_309491694.1 | PBSX family phage terminase large subunit | - |
| NC846_RS02555 (NC846_02540) | - | 478026..479411 (+) | 1386 | WP_229930265.1 | hypothetical protein | - |
| NC846_RS02560 (NC846_02545) | - | 479649..480845 (+) | 1197 | WP_003693452.1 | hypothetical protein | - |
| NC846_RS02565 (NC846_02550) | - | 480842..488149 (+) | 7308 | WP_229931400.1 | PLxRFG domain-containing protein | - |
| NC846_RS02570 (NC846_02555) | - | 488775..490070 (+) | 1296 | WP_003693441.1 | DUF4043 family protein | - |
| NC846_RS02575 (NC846_02560) | - | 490128..490601 (+) | 474 | WP_003693439.1 | hypothetical protein | - |
| NC846_RS02580 (NC846_02565) | - | 490607..491092 (+) | 486 | WP_003693438.1 | hypothetical protein | - |
| NC846_RS02585 (NC846_02570) | - | 491089..491763 (+) | 675 | WP_003693436.1 | hypothetical protein | - |
| NC846_RS02590 (NC846_02575) | - | 491766..491915 (+) | 150 | WP_017146863.1 | hypothetical protein | - |
| NC846_RS02595 (NC846_02580) | - | 491952..492803 (-) | 852 | WP_003699775.1 | Bro-N domain-containing protein | - |
Sequence
Protein
Download Length: 157 a.a. Molecular weight: 17429.25 Da Isoelectric Point: 9.7225
>NTDB_id=695629 NC846_RS02355 WP_172760650.1 453796..454269(+) (pilL) [Neisseria gonorrhoeae strain 10588]
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
MEQKGFTLIEMMIVVAILGIISVIAIPSYQSYIEKGYQSQLYTEMVGINNVLKQFILKNPLDDNQTIKTKLEIFVSGYKM
NPKIAKKYSVSVAFANTEKPRVYRLVGVPKAGTGYTLSVWMNSVGDGYKCRDAASAQAYSETLSANTGCEAFSNRKK
Nucleotide
Download Length: 474 bp
>NTDB_id=695629 NC846_RS02355 WP_172760650.1 453796..454269(+) (pilL) [Neisseria gonorrhoeae strain 10588]
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
ATGGAACAAAAAGGGTTTACATTGATTGAGATGATGATAGTTGTCGCGATACTCGGCATTATCAGCGTCATTGCCATACC
TTCTTATCAAAGTTATATTGAAAAAGGCTATCAGTCCCAGCTTTATACGGAGATGGTCGGTATCAACAATGTTCTCAAAC
AGTTTATTTTGAAAAATCCCCTGGACGATAATCAGACCATCAAGACCAAACTGGAAATATTTGTCTCAGGCTATAAGATG
AATCCGAAAATTGCCAAAAAATATAGTGTTTCGGTGGCATTTGCCAATACGGAAAAACCAAGGGTATACAGGTTGGTCGG
CGTTCCGAAGGCAGGGACGGGTTATACCTTGTCGGTATGGATGAACAGCGTGGGCGACGGATACAAATGCCGTGATGCCG
CTTCTGCCCAGGCCTATTCGGAGACCTTGTCCGCAAATACCGGCTGTGAAGCTTTCTCTAATCGTAAAAAATAG
3D structure
| Source | ID | Structure |
|---|
Similar proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|---|---|---|---|
| pilL | Neisseria gonorrhoeae MS11 |
91.083 |
100 |
0.911 |
| pilX | Neisseria meningitidis 8013 |
88.535 |
100 |
0.885 |