Detailed information    

insolico Bioinformatically predicted

Overview


Name   pilV   Type   Machinery gene
Locus tag   NC846_RS02340 Genome accession   NZ_CP098458
Coordinates   451646..452257 (+) Length   203 a.a.
NCBI ID   WP_003699626.1    Uniprot ID   -
Organism   Neisseria gonorrhoeae strain 10588     
Function   repress natural transformation (predicted from homology)   
Competence regulation

Related MGE


Note: This gene co-localizes with putative mobile genetic elements (MGEs) in the genome predicted by VRprofile2, as detailed below.

Gene-MGE association summary

MGE type MGE coordinates Gene coordinates Relative position Distance (bp)
Prophage 444114..492803 451646..452257 within 0


Gene organization within MGE regions


Location: 444114..492803
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  NC846_RS02300 (NC846_02285) - 444114..445190 (-) 1077 WP_003692814.1 sulfate/molybdate ABC transporter ATP-binding protein -
  NC846_RS02305 (NC846_02290) cysW 445187..446047 (-) 861 WP_003699617.1 sulfate ABC transporter permease subunit CysW -
  NC846_RS02310 (NC846_02295) cysT 446236..447063 (-) 828 WP_003699619.1 sulfate ABC transporter permease subunit CysT -
  NC846_RS02315 (NC846_02300) - 447244..447576 (+) 333 WP_003687908.1 hypothetical protein -
  NC846_RS02320 (NC846_02305) - 447903..448412 (+) 510 WP_003687909.1 isoprenylcysteine carboxyl methyltransferase family protein -
  NC846_RS02325 (NC846_02310) - 448644..449225 (-) 582 WP_003690895.1 superoxide dismutase -
  NC846_RS02330 (NC846_02315) dnaB 449389..450795 (+) 1407 WP_003699622.1 replicative DNA helicase -
  NC846_RS02335 (NC846_02320) pilH 450949..451614 (+) 666 WP_003699624.1 Tfp pilus assembly protein FimT/FimU Machinery gene
  NC846_RS02340 (NC846_02325) pilV 451646..452257 (+) 612 WP_003699626.1 type IV pilus modification protein PilV Machinery gene
  NC846_RS02345 (NC846_02330) pilJ 452254..453204 (+) 951 WP_263852724.1 PilW family protein Machinery gene
  NC846_RS02350 (NC846_02335) pilK 453183..453794 (+) 612 WP_033911077.1 PilX N-terminal domain-containing pilus assembly protein Machinery gene
  NC846_RS02355 (NC846_02340) pilL 453796..454269 (+) 474 WP_172760650.1 PilX family type IV pilin Machinery gene
  NC846_RS02360 (NC846_02345) - 454339..454647 (-) 309 WP_025456177.1 AzlD family protein -
  NC846_RS02365 (NC846_02350) - 454644..455354 (-) 711 Protein_464 AzlC family ABC transporter permease -
  NC846_RS02370 (NC846_02355) dut 455520..455972 (+) 453 WP_003699637.1 dUTP diphosphatase -
  NC846_RS02375 (NC846_02360) dapC 456048..457235 (+) 1188 WP_003699639.1 succinyldiaminopimelate transaminase -
  NC846_RS02380 (NC846_02365) yaaA 457391..458170 (+) 780 WP_003699641.1 peroxide stress protein YaaA -
  NC846_RS02395 (NC846_02380) - 458700..459893 (+) 1194 WP_017146746.1 phage integrase central domain-containing protein -
  NC846_RS02400 (NC846_02385) - 460249..460518 (-) 270 WP_003687928.1 hypothetical protein -
  NC846_RS02405 (NC846_02390) - 460713..461396 (-) 684 WP_003687929.1 DUF2786 domain-containing protein -
  NC846_RS11775 - 461677..461943 (-) 267 Protein_471 hypothetical protein -
  NC846_RS02415 (NC846_02400) - 462054..462269 (-) 216 WP_003691538.1 hypothetical protein -
  NC846_RS02420 (NC846_02405) - 462321..462812 (-) 492 WP_033911206.1 siphovirus Gp157 family protein -
  NC846_RS02425 (NC846_02410) - 462809..462991 (-) 183 WP_003691535.1 hypothetical protein -
  NC846_RS02430 (NC846_02415) - 463131..463817 (-) 687 WP_010357532.1 phage replication initiation protein, NGO0469 family -
  NC846_RS02435 (NC846_02420) - 463886..464047 (-) 162 WP_003693867.1 hypothetical protein -
  NC846_RS02440 (NC846_02425) - 464044..464322 (-) 279 WP_229930232.1 NGO1622 family putative holin -
  NC846_RS02445 (NC846_02430) - 464475..464807 (-) 333 WP_003695500.1 hypothetical protein -
  NC846_RS02450 (NC846_02435) - 464949..465242 (-) 294 WP_263852713.1 hypothetical protein -
  NC846_RS02455 (NC846_02440) - 465239..465715 (-) 477 WP_002255718.1 DUF6948 domain-containing protein -
  NC846_RS02460 (NC846_02445) - 465748..465948 (-) 201 WP_003692842.1 hypothetical protein -
  NC846_RS02465 (NC846_02450) - 466432..466650 (+) 219 WP_003691731.1 hypothetical protein -
  NC846_RS02470 (NC846_02455) - 466667..467026 (-) 360 WP_003691733.1 hypothetical protein -
  NC846_RS02475 (NC846_02460) - 467027..467566 (-) 540 WP_003695998.1 Panacea domain-containing protein -
  NC846_RS02480 (NC846_02465) - 467726..468442 (-) 717 WP_003695999.1 helix-turn-helix transcriptional regulator -
  NC846_RS02485 (NC846_02470) - 468823..469050 (+) 228 WP_003698261.1 helix-turn-helix domain-containing protein -
  NC846_RS02490 (NC846_02475) - 469168..470232 (+) 1065 WP_003689134.1 hypothetical protein -
  NC846_RS02495 (NC846_02480) - 470229..471590 (+) 1362 WP_003689132.1 DnaB-like helicase C-terminal domain-containing protein -
  NC846_RS02500 (NC846_02485) - 471607..471837 (+) 231 WP_012503490.1 hypothetical protein -
  NC846_RS02505 (NC846_02490) - 471929..472423 (+) 495 WP_003691434.1 DUF3310 domain-containing protein -
  NC846_RS02510 (NC846_02495) - 472806..472955 (+) 150 WP_033911194.1 phage associated protein -
  NC846_RS02515 (NC846_02500) - 472983..473264 (+) 282 WP_003689109.1 hypothetical protein -
  NC846_RS02520 (NC846_02505) - 473255..473692 (+) 438 WP_215217859.1 RusA family crossover junction endodeoxyribonuclease -
  NC846_RS02525 (NC846_02510) - 473685..473990 (+) 306 WP_025456182.1 DUF1364 domain-containing protein -
  NC846_RS02530 (NC846_02515) - 473987..474370 (+) 384 WP_003699764.1 recombination protein NinB -
  NC846_RS02535 (NC846_02520) - 474361..474879 (+) 519 WP_003693459.1 HNH endonuclease -
  NC846_RS02540 (NC846_02525) - 474944..475366 (+) 423 WP_003690919.1 hypothetical protein -
  NC846_RS02545 (NC846_02530) - 475366..475905 (+) 540 WP_003693457.1 hypothetical protein -
  NC846_RS02550 (NC846_02535) - 475886..477160 (+) 1275 WP_309491694.1 PBSX family phage terminase large subunit -
  NC846_RS02555 (NC846_02540) - 478026..479411 (+) 1386 WP_229930265.1 hypothetical protein -
  NC846_RS02560 (NC846_02545) - 479649..480845 (+) 1197 WP_003693452.1 hypothetical protein -
  NC846_RS02565 (NC846_02550) - 480842..488149 (+) 7308 WP_229931400.1 PLxRFG domain-containing protein -
  NC846_RS02570 (NC846_02555) - 488775..490070 (+) 1296 WP_003693441.1 DUF4043 family protein -
  NC846_RS02575 (NC846_02560) - 490128..490601 (+) 474 WP_003693439.1 hypothetical protein -
  NC846_RS02580 (NC846_02565) - 490607..491092 (+) 486 WP_003693438.1 hypothetical protein -
  NC846_RS02585 (NC846_02570) - 491089..491763 (+) 675 WP_003693436.1 hypothetical protein -
  NC846_RS02590 (NC846_02575) - 491766..491915 (+) 150 WP_017146863.1 hypothetical protein -
  NC846_RS02595 (NC846_02580) - 491952..492803 (-) 852 WP_003699775.1 Bro-N domain-containing protein -

Sequence


Protein


Download         Length: 203 a.a.        Molecular weight: 21997.01 Da        Isoelectric Point: 5.0177

>NTDB_id=695626 NC846_RS02340 WP_003699626.1 451646..452257(+) (pilV) [Neisseria gonorrhoeae strain 10588]
MKNNDCLRLKNPQSGMALIEVLVAMLVLTIGILALLSVQLRTVASVREAETQTIVSQITQNLMEGMLMNPTIDLDSNKKN
YSLYMGKQTPSAVDGKFTLDAEKSKAQLAEEQLKRFSYELKNALPDAVGIHYAVCKDSSGNEPTLSDSGVFSSNCDNKAN
GDTLIKVLWVNDSAGDSDISRTNLGVSGGNIVYTYQARVGGRE

Nucleotide


Download         Length: 612 bp        

>NTDB_id=695626 NC846_RS02340 WP_003699626.1 451646..452257(+) (pilV) [Neisseria gonorrhoeae strain 10588]
ATGAAGAATAATGATTGCTTGCGCCTGAAAAATCCCCAGTCCGGTATGGCGCTGATAGAAGTCTTGGTTGCTATGCTCGT
TCTGACCATCGGTATTTTGGCATTGCTGTCCGTGCAGCTGCGGACGGTCGCTTCCGTCAGGGAAGCGGAGACGCAAACCA
TCGTCAGCCAAATCACGCAAAACCTGATGGAAGGAATGTTGATGAATCCGACCATTGATTTGGATAGCAACAAGAAAAAC
TATAGTCTTTACATGGGAAAACAGACACCATCAGCTGTGGATGGTAAGTTTACGCTTGATGCCGAGAAAAGTAAGGCGCA
GTTGGCAGAGGAACAATTGAAGAGATTTAGTTATGAGCTGAAAAATGCCTTGCCGGATGCGGTCGGTATTCATTACGCCG
TCTGCAAGGATTCGTCGGGTAACGAGCCGACATTGTCCGACAGCGGTGTTTTTTCTTCAAATTGCGACAATAAGGCAAAC
GGGGATACTTTGATTAAAGTATTGTGGGTAAATGATTCGGCAGGGGATTCGGATATTTCCCGTACGAATCTTGGGGTGAG
CGGCGGCAATATCGTATATACTTATCAGGCAAGGGTCGGAGGTCGTGAATGA


Secondary structure


Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure


Source ID Structure

Transmembrane helices


Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.



Visualization of predicted probability:


Similar proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  pilV Neisseria meningitidis 8013

87.44

100

0.892

  pilI Neisseria gonorrhoeae MS11

82.759

100

0.828

  pilV Neisseria gonorrhoeae MS11

82.759

100

0.828