Detailed information    

insolico Bioinformatically predicted

Overview

Name   degQ   Type   Regulator
Locus tag   BVS141_RS15045 Genome accession   NZ_AP018402
Coordinates   3048647..3048787 (-) Length   46 a.a.
NCBI ID   WP_003152043.1    Uniprot ID   A3KLB4
Organism   Bacillus velezensis strain S141     
Function   modification of regulators (predicted from homology)   
Competence regulation

Genomic Context

Location: 3043647..3053787
Locus tag Gene name Coordinates (strand) Size (bp) Protein ID Product Description
  BVS141_RS15020 (BVS141_29850) - 3043961..3044344 (-) 384 WP_012118312.1 hotdog fold thioesterase -
  BVS141_RS15025 (BVS141_29860) comA 3044366..3045010 (-) 645 WP_003152052.1 response regulator transcription factor Regulator
  BVS141_RS15030 comP 3045091..3047442 (-) 2352 WP_269461318.1 sensor histidine kinase Regulator
  BVS141_RS15035 (BVS141_29880) comX 3047420..3047590 (-) 171 WP_015418105.1 competence pheromone ComX -
  BVS141_RS15040 (BVS141_29890) - 3047587..3048516 (-) 930 WP_231945405.1 polyprenyl synthetase family protein -
  BVS141_RS15045 (BVS141_29900) degQ 3048647..3048787 (-) 141 WP_003152043.1 degradation enzyme regulation protein DegQ Regulator
  BVS141_RS15055 (BVS141_29910) - 3049252..3049593 (+) 342 WP_060561880.1 hypothetical protein -
  BVS141_RS15060 (BVS141_29920) - 3049600..3050823 (-) 1224 WP_007408678.1 EAL and HDOD domain-containing protein -
  BVS141_RS15065 (BVS141_29930) - 3050953..3052419 (-) 1467 WP_020954301.1 nicotinate phosphoribosyltransferase -
  BVS141_RS15070 (BVS141_29940) - 3052437..3052988 (-) 552 WP_060561881.1 cysteine hydrolase family protein -
  BVS141_RS15075 (BVS141_29950) - 3053085..3053483 (-) 399 WP_003152031.1 YueI family protein -

Sequence

Protein


Download         Length: 46 a.a.        Molecular weight: 5518.30 Da        Isoelectric Point: 4.9432

>NTDB_id=69534 BVS141_RS15045 WP_003152043.1 3048647..3048787(-) (degQ) [Bacillus velezensis strain S141]
MENKLEEVKQLLFRLENDIRETTDSLRNINKSIDQLDKFSYAMKIS

Nucleotide


Download         Length: 141 bp        

>NTDB_id=69534 BVS141_RS15045 WP_003152043.1 3048647..3048787(-) (degQ) [Bacillus velezensis strain S141]
GTGGAAAACAAATTAGAAGAAGTAAAGCAATTATTATTCCGACTTGAAAATGATATCAGAGAAACAACCGACTCATTACG
AAACATTAACAAAAGCATTGATCAGCTCGATAAATTCTCATATGCAATGAAAATTTCTTAA

Domains

Predicted by InterproScan.

DegQ (SacQ) family (DegQ)

(1-46)


Secondary structure

Protein secondary structures were predicted by S4PRED and visualized by seqviz.



3D structure

Source ID Structure
  AlphaFold DB A3KLB4

Transmembrane helices

Transmembrane helices of protein were predicted by TMHMM 2.0 and visualized by seqviz and ECharts.


Visualization of predicted probability:


Similar proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
  degQ Bacillus subtilis subsp. subtilis str. 168

89.13

100

0.891

Multiple sequence alignment